⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2405 [new locus tag: SACOL_RS12620 ]
- pan locus tag?: SAUPAN005940000
- symbol: SACOL2405
- pan gene symbol?: —
- synonym:
- product: addiction module antitoxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2405 [new locus tag: SACOL_RS12620 ]
- symbol: SACOL2405
- product: addiction module antitoxin
- replicon: chromosome
- strand: -
- coordinates: 2466782..2467033
- length: 252
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238589 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGATTATTAAAAATTATTCATACGCTCGACAGAATTTAAAGGCACTTATGACAAAAGTA
AATGATGATAGTGATATGGTAACTGTAACATCTACTGATGATAAAAACGTAGTAATCATG
TCAGAATCAGATTATAACTCCATGATGGAAACACTTTACCTCCAACAGAACCCAAATAAT
GCTGAACACTTAGCTCAATCAATTGCAGATCTAGAACGTGGGAAAACTATAACGAAAGAT
ATAGATGTATAA60
120
180
240
252
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2405 [new locus tag: SACOL_RS12620 ]
- symbol: SACOL2405
- description: addiction module antitoxin
- length: 83
- theoretical pI: 4.3408
- theoretical MW: 9433.56
- GRAVY: -0.546988
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance prevent-host-death family protein (TIGR01552; HMM-score: 27.1)Mobile and extrachromosomal element functions Other prevent-host-death family protein (TIGR01552; HMM-score: 27.1)
- TheSEED :
- Antitoxin DinJ (binds YafQ toxin)
- PFAM: Plasmid-antitox (CL0136) PhdYeFM_antitox; Antitoxin Phd_YefM, type II toxin-antitoxin system (PF02604; HMM-score: 74.7)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005814
- TAT(Tat/SPI): 0.000251
- LIPO(Sec/SPII): 0.000898
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNNAEHLAQSIADLERGKTITKDIDV
⊟Peptides[edit | edit source]
- experimentally validated: data available for NCTC8325
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.