NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2091 [new locus tag: SACOL_RS10940 ]
- pan locus tag?: SAUPAN005387000
- symbol: fabZ
- pan gene symbol?: fabZ
- synonym:
- product: (3R)-hydroxymyristoyl-ACP dehydratase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2091 [new locus tag: SACOL_RS10940 ]
- symbol: fabZ
- product: (3R)-hydroxymyristoyl-ACP dehydratase
- replicon: chromosome
- strand: -
- coordinates: 2154070..2154510
- length: 441
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238676 NCBI
- RefSeq: YP_186906 NCBI
- BioCyc: see SACOL_RS10940
- MicrobesOnline: 913567 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGAAACAATTTTTGATTATAACCAAATTAAACAAATTATACCTCACAGACAGCCATTT
TTATTAATTGATAAAGTAGTTGAATATGAAGAAGGTCAACGTTGTGTGGCTATTAAACAA
GTATCAGGAAACGAACCATTCTTTCAAGGGCATTTTCCTGAGTATGCGGTAATGCCAGGC
GTATTAATTACTGAAGCGTTAGCTCAAACAGGTGCGGTAGCTATTTTAAATAGTGAAGAA
AATAAAGGTAAAATCGCTTTATTTGCTGGTATTGATAAATGTCGTTTTAAACGTCAAGTA
GTACCTGGTGATACTTTAACGTTGGAAGTAGAAATCACTAAAATTAAAGGACCAATAGGT
AAAGGTAATGCTAAAGCTACTGTCGATGGTCAACTTGCTTGTAGTTGTGAACTTACATTT
GCAATTCAAGATGTAAAATAA60
120
180
240
300
360
420
441
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2091 [new locus tag: SACOL_RS10940 ]
- symbol: FabZ
- description: (3R)-hydroxymyristoyl-ACP dehydratase
- length: 146
- theoretical pI: 5.78053
- theoretical MW: 16081.5
- GRAVY: -0.0369863
⊟Function[edit | edit source]
- reaction: EC 4.2.1.59? ExPASy3-hydroxyacyl-[acyl-carrier-protein] dehydratase A (3R)-3-hydroxyacyl-[acyl-carrier protein] = a trans-2-enoyl-[acyl-carrier protein] + H2O
- TIGRFAM: Fatty acid and phospholipid metabolism Biosynthesis beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ (TIGR01750; EC 4.2.1.-; HMM-score: 176.9)and 1 moreFatty acid and phospholipid metabolism Biosynthesis beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA (TIGR01749; EC 4.2.1.59; HMM-score: 24.2)
- TheSEED :
- 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
- PFAM: HotDog (CL0050) FabA; FabA-like domain (PF07977; HMM-score: 115.3)and 3 moreMaoC_dehydratas; MaoC like domain (PF01575; HMM-score: 22)4HBT; Thioesterase superfamily (PF03061; HMM-score: 21.1)4HBT_2; Thioesterase-like superfamily (PF13279; HMM-score: 14.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002824
- TAT(Tat/SPI): 0.000158
- LIPO(Sec/SPII): 0.000279
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- METIFDYNQIKQIIPHRQPFLLIDKVVEYEEGQRCVAIKQVSGNEPFFQGHFPEYAVMPGVLITEALAQTGAVAILNSEENKGKIALFAGIDKCRFKRQVVPGDTLTLEVEITKIKGPIGKGNAKATVDGQLACSCELTFAIQDVK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 12.78 h [8]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)