NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2061 [new locus tag: SACOL_RS10790 ]
- pan locus tag?: SAUPAN005342000
- symbol: acpS
- pan gene symbol?: acpS
- synonym:
- product: 4'-phosphopantetheinyl transferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2061 [new locus tag: SACOL_RS10790 ]
- symbol: acpS
- product: 4'-phosphopantetheinyl transferase
- replicon: chromosome
- strand: -
- coordinates: 2126043..2126402
- length: 360
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238092 NCBI
- RefSeq: YP_186877 NCBI
- BioCyc: see SACOL_RS10790
- MicrobesOnline: 913538 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATACATGGAATTGGTGTAGATTTAATCGAAATCGATCGAATACAAGCGTTATATAGT
AAGCAACCAAAATTGGTTGAGCGGATTTTAACTAAAAATGAACAGCACAAATTCAACAAT
TTCACACATGAGCAACGTAAAATTGAATTTTTAGCTGGCAGGTTTGCTACAAAAGAAGCG
TTCAGTAAAGCATTAGGCACAGGCTTAGGAAAACATGTAGCTTTTAACGATATAGACTGT
TACAACGACGAACTTGGCAAACCAAAGATTGATTACGAAGGGTTTATCGTACATGTTAGT
ATCTCACACACTGAGCATTATGCGATGAGCCAAGTTGTTTTAGAAAAGTCAGCATTTTAA60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2061 [new locus tag: SACOL_RS10790 ]
- symbol: AcpS
- description: 4'-phosphopantetheinyl transferase
- length: 119
- theoretical pI: 7.2338
- theoretical MW: 13605.5
- GRAVY: -0.319328
⊟Function[edit | edit source]
- reaction: EC 2.7.8.7? ExPASyHolo-[acyl-carrier-protein] synthase CoA-(4'-phosphopantetheine) + apo-[acyl-carrier-protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier-protein]
- TIGRFAM: Fatty acid and phospholipid metabolism Biosynthesis holo-[acyl-carrier-protein] synthase (TIGR00516; EC 2.7.8.7; HMM-score: 116.8)Protein fate Protein modification and repair phosphopantetheine--protein transferase domain (TIGR00556; HMM-score: 94.6)
- TheSEED :
- Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)
- PFAM: no clan defined ACPS; 4'-phosphopantetheinyl transferase superfamily (PF01648; HMM-score: 67.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Mg2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005087
- TAT(Tat/SPI): 0.001297
- LIPO(Sec/SPII): 0.001368
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIHGIGVDLIEIDRIQALYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)