NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1853 [new locus tag: SACOL_RS09505 ]
- pan locus tag?: SAUPAN004532000
- symbol: SACOL1853
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1853 [new locus tag: SACOL_RS09505 ]
- symbol: SACOL1853
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1905286..1905462
- length: 177
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGATAGATTAAAATATTCACTTAAAGTTGGAATTTTAGCATTATTATTATTTTGTACT
TTAAATTATTTAGTTCCAATGCAAAGCAATGCTTTTTCAATAATTATATATTCGGCAATT
TTTGCTGTGTTACTTATGCTTTTAGTTTATATATTTTTAGGAATTTTAAAGAAATGA60
120
177
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1853 [new locus tag: SACOL_RS09505 ]
- symbol: SACOL1853
- description: hypothetical protein
- length: 58
- theoretical pI: 9.92669
- theoretical MW: 6614.25
- GRAVY: 1.42241
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance bacteriocin-associated integral membrane protein (TIGR01654; HMM-score: 7.3)
- TheSEED: data available for NCTC8325
- PFAM: Hypoth_1 (CL0447) DUF3784; Domain of unknown function (DUF3784) (PF12650; HMM-score: 13.4)and 1 moreno clan defined Renin_r; Renin receptor-like protein (PF07850; HMM-score: 7.9)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.050714
- TAT(Tat/SPI): 0.00196
- LIPO(Sec/SPII): 0.339636
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDRLKYSLKVGILALLLFCTLNYLVPMQSNAFSIIIYSAIFAVLLMLLVYIFLGILKK
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.