From AureoWiki
Revision as of 02:23, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1833 [new locus tag: SACOL_RS09400 ]
  • pan locus tag?: SAUPAN004483000
  • symbol: SACOL1833
  • pan gene symbol?: crcB2
  • synonym:
  • product: crcB family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1833 [new locus tag: SACOL_RS09400 ]
  • symbol: SACOL1833
  • product: crcB family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1887053..1887406
  • length: 354
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATATCAATCATTTTAGTCATGATTGGCGGCGGTTTTGGCGCAATTGCTAGAAGTGCC
    ATTACTGATTATTTTAATCATAAATTTACTTCAAAGTTACCTATCGCAACATTGATAGTA
    AATCTAGTTGGTAGTTTTTTAATTGGATTAACTATAGGCTTATCAATTTCAACCTCATGG
    TTCCCTGCGTTCTTTGTTACCGGTTTTTTAGGTGGCTTAACAACTTTCTCAACGTTAGCC
    AAAGAACTTACACTAATGATGACGCCAAAATTTAATATTAACCTTTTTCTCAATTATTCA
    CTTTTACAATTCATCATTGGATTTATAGCTTGTTATATTGGCTATCATATTTAA
    60
    120
    180
    240
    300
    354

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1833 [new locus tag: SACOL_RS09400 ]
  • symbol: SACOL1833
  • description: crcB family protein
  • length: 117
  • theoretical pI: 9.58674
  • theoretical MW: 12784.2
  • GRAVY: 1.09487

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General protein CrcB (TIGR00494; HMM-score: 69.1)
  • TheSEED: data available for N315, NCTC8325, USA300_FPR3757
  • PFAM:
    DMT (CL0184) CRCB; CrcB-like protein, Camphor Resistance (CrcB) (PF02537; HMM-score: 75)
    and 2 more
    no clan defined MlaE; Permease MlaE (PF02405; HMM-score: 8.8)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 7.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006967
    • TAT(Tat/SPI): 0.000296
    • LIPO(Sec/SPII): 0.03267
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISTSWFPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: Integral membrane [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]