NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1792 [new locus tag: SACOL_RS09185 ]
- pan locus tag?: SAUPAN004409000
- symbol: SACOL1792
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1792 [new locus tag: SACOL_RS09185 ]
- symbol: SACOL1792
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1840963..1841559
- length: 597
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236017 NCBI
- RefSeq: YP_186625 NCBI
- BioCyc: see SACOL_RS09185
- MicrobesOnline: 913236 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAATTTATTTTACAATCCTAAATATGTAGGAGATGTCGCATTTTTACAAATTGAACCA
GTTGAAGGTGAATTAAACTACAATAAAAAAGGTAATGTTGTTGAAATTACTAATGAAGGT
AATGTTGTAGGTTATAATATTTTTGAAATTTCAAAAGATATAACAATTGAAGAAAAAGGT
CATATTAAATTAACTGATGAACTTGTAAATGTATTCCAAAAGCGTATTTCAGAAGCTGGT
TTTGATTATAAATTAAATGCTGATCTATCACCGAAATTTGTAGTTGGCTACGTTGAAACT
AAAGACAAACATCCTGATGCAGATAAATTAAGTGTACTAAATGTAAACGTTGGAAATGAC
ACATTACAAATTGTATGTGGCGCGCCTAACGTTGAAGCTGGACAGAAAGTTGTTGTTGCT
AAAGTAGGTGCAGTGATGCCTAGCGGTATGGTAATTAAAGATGCTGAATTACGTGGTGTT
GCCTCAAGCGGTATGATTTGTTCAATGAAAGAATTGAATTTACCTAATGCACCTGAAGAA
AAAGGTATTATGGTATTAAATGACAGCTATGAAATTGGACAAGCATTTTTTGAATAA60
120
180
240
300
360
420
480
540
597
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1792 [new locus tag: SACOL_RS09185 ]
- symbol: SACOL1792
- description: hypothetical protein
- length: 198
- theoretical pI: 4.4561
- theoretical MW: 21689.7
- GRAVY: -0.113636
⊟Function[edit | edit source]
- reaction: EC 6.1.1.20? ExPASyPhenylalanine--tRNA ligase ATP + L-phenylalanine + tRNA(Phe) = AMP + diphosphate + L-phenylalanyl-tRNA(Phe)
- TIGRFAM: Protein synthesis tRNA aminoacylation phenylalanine--tRNA ligase, beta subunit (TIGR00472; EC 6.1.1.20; HMM-score: 145)and 1 moreProtein synthesis tRNA aminoacylation methionine--tRNA ligase, beta subunit (TIGR00399; EC 6.1.1.10; HMM-score: 24.4)
- TheSEED :
- Phenylalanyl-tRNA synthetase domain protein (Bsu YtpR)
- PFAM: OB (CL0021) tRNA_bind; Putative tRNA binding domain (PF01588; HMM-score: 84.3)no clan defined DUF4479; Domain of unknown function (DUF4479) (PF14794; HMM-score: 76.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Mg2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008349
- TAT(Tat/SPI): 0.000172
- LIPO(Sec/SPII): 0.000992
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNLFYNPKYVGDVAFLQIEPVEGELNYNKKGNVVEITNEGNVVGYNIFEISKDITIEEKGHIKLTDELVNVFQKRISEAGFDYKLNADLSPKFVVGYVETKDKHPDADKLSVLNVNVGNDTLQIVCGAPNVEAGQKVVVAKVGAVMPSGMVIKDAELRGVASSGMICSMKELNLPNAPEEKGIMVLNDSYEIGQAFFE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 20.1 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)