From AureoWiki
Revision as of 12:37, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1675 [new locus tag: SACOL_RS08545 ]
  • pan locus tag?: SAUPAN004218000
  • symbol: SACOL1675
  • pan gene symbol?: —
  • synonym:
  • product: TPR domain-containing protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1675 [new locus tag: SACOL_RS08545 ]
  • symbol: SACOL1675
  • product: TPR domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1704671..1705339
  • length: 669
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAGATCAACAAACAATTTATCAATACATACAAAATGGAAAAATAGAAGAAGCGTTA
    CAAGCATTGTTCGGAAATATCGAAGAAAATCCTACAATTATTGAAAATTATATTAATGCT
    GGTATCGTACTTGCTGATGCGAATGAGATTGAAAAGGCAGAGCGTTTTTTCCAAAAAGCT
    TTAACAATAGATCCGAAGAATGGCGTCGTATTTTTTAATCTAGCAAATGTATATTATAAT
    CAGCAACGTTATCAAGAAGCTATTAAATTATATCAACAAGCATTACAAACAGAGATTGAA
    CAAGTTGATTGTAATTATATGATCGGTATGGCGTTTAATCAGTTAGAATCATTTAAGCTG
    GCATTGCCGTATTTAATGACTGCTGCGGAACTAGATAAAGACAAAGATGCAGAAGTTCAA
    TTTCAATATGGTCTTGTATTATGTCAATTAGAAATGTTTAATGAAGCCATAACTCAACTT
    AAACATGTATTAACGATTGATAAAAATCATGTTGATGCAAGATACAATTTGGGCTTAGCG
    TTATTTATGAAAAATGAAGATATTGATGAAGCAATAACTCATTTTAAAGAAGCTGTGACT
    ATCGACCCTAAACACTTATTAAGTCAGCATGCGCTGAAAACATTCACTAAAATGAAAGAG
    GAGGAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    669

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1675 [new locus tag: SACOL_RS08545 ]
  • symbol: SACOL1675
  • description: TPR domain-containing protein
  • length: 222
  • theoretical pI: 4.41965
  • theoretical MW: 25701.1
  • GRAVY: -0.277477

⊟Function[edit | edit source]

  • TIGRFAM:
    type IV pilus biogenesis/stability protein PilW (TIGR02521; HMM-score: 72.1)
    putative PEP-CTERM system TPR-repeat lipoprotein (TIGR02917; HMM-score: 70.8)
    and 8 more
    type III secretion low calcium response chaperone LcrH/SycD (TIGR02552; HMM-score: 56.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines mitochondrial precursor proteins import receptor (TIGR00990; HMM-score: 49.8)
    tol-pal system protein YbgF (TIGR02795; HMM-score: 31.4)
    putative peptide modification system cyclase (TIGR04510; HMM-score: 26.2)
    Unknown function General heme biosynthesis-associated TPR protein (TIGR00540; HMM-score: 24.5)
    pentatricopeptide repeat domain (TIGR00756; HMM-score: 21.9)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides adenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 21.4)
    poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA (TIGR03939; HMM-score: 20.7)
  • TheSEED  :
    • Tetratricopeptide repeat (TPR) family protein
  • PFAM:
    TPR (CL0020) TPR_1; Tetratricopeptide repeat (PF00515; HMM-score: 100)
    TPR_2; Tetratricopeptide repeat (PF07719; HMM-score: 99.7)
    TPR_8; Tetratricopeptide repeat (PF13181; HMM-score: 93.7)
    TPR_11; TPR repeat (PF13414; HMM-score: 86.9)
    TPR_12; Tetratricopeptide repeat (PF13424; HMM-score: 80.2)
    and 23 more
    TPR_17; Tetratricopeptide repeat (PF13431; HMM-score: 64.5)
    TPR_19; Tetratricopeptide repeat (PF14559; HMM-score: 63.2)
    TPR_16; Tetratricopeptide repeat (PF13432; HMM-score: 59.9)
    TPR_14; Tetratricopeptide repeat (PF13428; HMM-score: 59.4)
    ANAPC3; Anaphase-promoting complex, cyclosome, subunit 3 (PF12895; HMM-score: 53.3)
    TPR_7; Tetratricopeptide repeat (PF13176; HMM-score: 52.4)
    TPR_10; Tetratricopeptide repeat (PF13374; HMM-score: 47.6)
    TPR_6; Tetratricopeptide repeat (PF13174; HMM-score: 42.5)
    TPR_20; Tetratricopeptide repeat (PF14561; HMM-score: 35.5)
    TOM20_plant; Plant specific mitochondrial import receptor subunit TOM20 (PF06552; HMM-score: 28.3)
    TPR_9; Tetratricopeptide repeat (PF13371; HMM-score: 28.1)
    TPR_3; Tetratricopeptide repeat (PF07720; HMM-score: 26.8)
    PPR; PPR repeat (PF01535; HMM-score: 24.8)
    TPR_15; Tetratricopeptide repeat (PF13429; HMM-score: 22.2)
    no clan defined MIT; MIT (microtubule interacting and transport) domain (PF04212; HMM-score: 21.5)
    TPR (CL0020) PPR_2; PPR repeat family (PF13041; HMM-score: 18)
    NARP1; NMDA receptor-regulated protein 1 (PF12569; HMM-score: 16.8)
    TPR_21; Tetratricopeptide repeat-like domain (PF09976; HMM-score: 16.4)
    TPR_4; Tetratricopeptide repeat (PF07721; HMM-score: 15.8)
    Hect (CL0552) HECT_2; HECT-like Ubiquitin-conjugating enzyme (E2)-binding (PF09814; HMM-score: 15.3)
    TPR (CL0020) Fis1_TPR_C; Fis1 C-terminal tetratricopeptide repeat (PF14853; HMM-score: 13)
    Clathrin; Region in Clathrin and VPS (PF00637; HMM-score: 12.1)
    Sel1; Sel1 repeat (PF08238; HMM-score: 11.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004087
    • TAT(Tat/SPI): 0.000163
    • LIPO(Sec/SPII): 0.000383
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIDQQTIYQYIQNGKIEEALQALFGNIEENPTIIENYINAGIVLADANEIEKAERFFQKALTIDPKNGVVFFNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKLALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLALFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 141 [5]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1675&oldid=99505"