From AureoWiki
Revision as of 12:17, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1638 [new locus tag: SACOL_RS08350 ]
  • pan locus tag?: SAUPAN004164000
  • symbol: grpE
  • pan gene symbol?: grpE
  • synonym:
  • product: heat shock protein GrpE

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1638 [new locus tag: SACOL_RS08350 ]
  • symbol: grpE
  • product: heat shock protein GrpE
  • replicon: chromosome
  • strand: -
  • coordinates: 1668475..1669101
  • length: 627
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGACAAATAAAGACGAATCAGTTAAAAAAAACACTGAATCAACAGTTGAAGAAACAAAC
    GTCAAACAAAATATTGATGATTCAGTTGAACAAGCTGAAGAAAGTAAAGGTCATTTACAA
    GATGAAGCAATAGAAGAAACGTCTGACGAGAATGTTATTGAAGAAATAGATCCAAAAGAT
    CAAAAAATTAATGAACTTCAACAATTAGCAGATGAAAACGAAGAGAAATATTTAAGGCTC
    TACGCTGAGTTTGAAAATTATAAGCGTAGAATTCAAAAAGAAAATGAAATAAACAAAACA
    TATCAAGCACAACGTGTGTTAACAGATATTTTACCAGCAATAGACAATATAGAACGTGCA
    CTTCAAATTGAAGGTGATGATGAGACTTTTAAATCTCTTCAAAAAGGTGTACAAATGGTG
    CATGAAAGTTTGATTAACGCACTAAAAGATAATGGTCTTGAAGTTATTAAAACTGAAGGT
    GAAGCATTTGATCCAAATATTCACCAAGCTGTAGTTCAAGATGATAACCCTGATTTTGAA
    TCTGGCGAAATCACTCAAGAACTACAAAAAGGATACAAGCTTAAAGATAGAGTATTAAGA
    CCATCAATGGTCAAAGTAAACCAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1638 [new locus tag: SACOL_RS08350 ]
  • symbol: GrpE
  • description: heat shock protein GrpE
  • length: 208
  • theoretical pI: 4.19699
  • theoretical MW: 24007.2
  • GRAVY: -1.03606

Function[edit | edit source]

  • TIGRFAM:
    chain length determinant protein EpsF (TIGR03017; HMM-score: 9.6)
  • TheSEED  :
    • Heat shock protein GrpE
    Protein Metabolism Protein folding Protein chaperones  Heat shock protein GrpE
    and 1 more
    Stress Response Heat shock Heat shock dnaK gene cluster extended  Heat shock protein GrpE
  • PFAM:
    no clan defined GrpE; GrpE (PF01025; HMM-score: 162.4)
    and 2 more
    RPW8; Arabidopsis broad-spectrum mildew resistance protein RPW8 (PF05659; HMM-score: 12.7)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 6.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008465
    • TAT(Tat/SPI): 0.002885
    • LIPO(Sec/SPII): 0.002327
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTNKDESVKKNTESTVEETNVKQNIDDSVEQAEESKGHLQDEAIEETSDENVIEEIDPKDQKINELQQLADENEEKYLRLYAEFENYKRRIQKENEINKTYQAQRVLTDILPAIDNIERALQIEGDDETFKSLQKGVQMVHESLINALKDNGLEVIKTEGEAFDPNIHQAVVQDDNPDFESGEITQELQKGYKLKDRVLRPSMVKVNQ

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 2217 [5]
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: HrcA (repression) regulon
    HrcA(TF)important in Heat shock response; RegPrecise    transcription unit transferred from N315 data RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 19.49 h [7]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. Arnaud Chastanet, Juliette Fert, Tarek Msadek
    Comparative genomics reveal novel heat shock regulatory mechanisms in Staphylococcus aureus and other Gram-positive bacteria.
    Mol Microbiol: 2003, 47(4);1061-73
    [PubMed:12581359] [WorldCat.org] [DOI] (P p)
  7. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]