From AureoWiki
Revision as of 10:59, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1624 [new locus tag: SACOL_RS08280 ]
  • pan locus tag?: SAUPAN004148000
  • symbol: era
  • pan gene symbol?: era
  • synonym:
  • product: GTP-binding protein Era

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1624 [new locus tag: SACOL_RS08280 ]
  • symbol: era
  • product: GTP-binding protein Era
  • replicon: chromosome
  • strand: -
  • coordinates: 1655751..1656650
  • length: 900
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGACAGAACATAAATCAGGATTTGTTTCAATTATAGGTAGACCAAATGTAGGAAAGTCA
    ACATTTGTTAATAGAGTGATCGGCCATAAAATAGCAATCATGTCCGATAAAGCTCAAACA
    ACTAGAAATAAAATTCAAGGTGTTATGACAAGAGATGACGCGCAAATTATATTCATTGAT
    ACGCCAGGTATTCATAAACCTAAACACAAATTAGGTGACTATATGATGAAAGTCGCTAAA
    AATACATTATCTGAGATAGATGCAATCATGTTTATGGTTAATGCCAATGAGGAAATTGGA
    CGAGGCGATGAATATATTATAGAAATGTTGAAAAATGTTAAGACACCAGTATTTTTAGTA
    TTAAATAAAATAGATTTAGTGCATCCAGATGAATTAATGCCAAAGATTGAAGAATATCAA
    AGTTATATGGACTTTACAGAGATTGTACCTATTTCAGCATTAGAAGGGCTAAATGTCGAT
    CATTTTATTGATGTTTTAAAGACGTATTTACCCGAAGGACCTAAATATTATCCAGATGAT
    CAAATTTCAGACCATCCTGAACAATTTGTAGTGGGTGAAATCATTCGTGAAAAAATCCTT
    CATCTTACAAGTGAAGAAATCCCTCATGCGATTGGTGTTAATGTGGACCGTATGGTTAAA
    GAAAGCGAAGATCGTGTTCATATCGAAGCAACTATATATGTTGAAAGAGATTCGCAAAAA
    GGAATTGTCATTGGAAAAGGCGGTAAAAAGTTAAAAGAAGTAGGAAAACGTGCGAGACGT
    GATATAGAAATGCTTCTAGGCTCTAAAGTTTACTTAGAATTATGGGTCAAAGTTCAAAGA
    GACTGGCGAAACAAAGTTAACTTTATTCGCCAAATTGGTTATGTTGAAGACCAAGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1624 [new locus tag: SACOL_RS08280 ]
  • symbol: Era
  • description: GTP-binding protein Era
  • length: 299
  • theoretical pI: 6.5234
  • theoretical MW: 34328.5
  • GRAVY: -0.353846

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 351)
    and 18 more
    Genetic information processing Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 133.5)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 96.4)
    Genetic information processing Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 79.4)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 71.4)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 57.9)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 54.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 41.5)
    Genetic information processing Protein synthesis Other Obg family GTPase CgtA (TIGR02729; HMM-score: 41.2)
    Unknown function General GTP-binding protein HflX (TIGR03156; HMM-score: 40.1)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 37.5)
    Genetic information processing Protein synthesis Translation factors translation initiation factor IF-2 (TIGR00487; HMM-score: 35.1)
    translation initiation factor 2, gamma subunit (TIGR03680; HMM-score: 34.2)
    Metabolism Transport and binding proteins Nucleosides, purines and pyrimidines GTP-binding protein (TIGR00991; HMM-score: 20.7)
    Genetic information processing Protein synthesis Translation factors translation initiation factor aIF-2 (TIGR00491; HMM-score: 19.8)
    Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines chloroplast protein import component Toc86/159, G and M domains (TIGR00993; HMM-score: 15.1)
    nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 13.5)
    Genetic information processing Protein synthesis Translation factors peptide chain release factor 3 (TIGR00503; HMM-score: 13.4)
  • TheSEED  :
    • GTP-binding protein Era
    Protein Metabolism Protein biosynthesis Universal GTPases  GTP-binding protein Era
    and 1 more
    RNA Metabolism RNA processing and modification tRNA modification Archaea  GTP-binding protein Era
  • PFAM:
    P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 86.7)
    KH (CL0007) KH_2; KH domain (PF07650; HMM-score: 81.9)
    and 16 more
    P-loop_NTPase (CL0023) FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 50.1)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 48)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 45.2)
    AIG1; AIG1 family (PF04548; HMM-score: 32.3)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 29.1)
    PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 23.4)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 21.9)
    no clan defined MMR_HSR1_Xtn; C-terminal region of MMR_HSR1 domain (PF16897; HMM-score: 19.9)
    P-loop_NTPase (CL0023) Ras; Ras family (PF00071; HMM-score: 19.3)
    Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 16.7)
    Gtr1_RagA; Gtr1/RagA G protein conserved region (PF04670; HMM-score: 14.5)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 14.1)
    MMR_HSR1_C; GTPase of unknown function C-terminal (PF08438; HMM-score: 13.2)
    KH (CL0007) KH_4; KH domain (PF13083; HMM-score: 12.8)
    P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 12.6)
    KH (CL0007) KH_1; KH domain (PF00013; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003811
    • TAT(Tat/SPI): 0.00048
    • LIPO(Sec/SPII): 0.000587
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTEHKSGFVSIIGRPNVGKSTFVNRVIGHKIAIMSDKAQTTRNKIQGVMTRDDAQIIFIDTPGIHKPKHKLGDYMMKVAKNTLSEIDAIMFMVNANEEIGRGDEYIIEMLKNVKTPVFLVLNKIDLVHPDELMPKIEEYQSYMDFTEIVPISALEGLNVDHFIDVLKTYLPEGPKYYPDDQISDHPEQFVVGEIIREKILHLTSEEIPHAIGVNVDRMVKESEDRVHIEATIYVERDSQKGIVIGKGGKKLKEVGKRARRDIEMLLGSKVYLELWVKVQRDWRNKVNFIRQIGYVEDQD

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 251 [4]
  • interaction partners:
    SACOL1782(fhs)formate--tetrahydrofolate ligase  [5] (data from MRSA252)
    SACOL0838(gapA1)glyceraldehyde 3-phosphate dehydrogenase  [5] (data from MRSA252)
    SACOL1206(ileS)isoleucyl-tRNA synthetase  [5] (data from MRSA252)
    SACOL1285(nusA)transcription elongation factor NusA  [5] (data from MRSA252)
    SACOL1091(ptsH)phosphocarrier protein HPr  [5] (data from MRSA252)
    SACOL0585(rplJ)50S ribosomal protein L10  [5] (data from MRSA252)
    SACOL2233(rpsC)30S ribosomal protein S3  [5] (data from MRSA252)
    SACOL0731LysR family transcriptional regulator  [5] (data from MRSA252)
    SACOL0832hypothetical protein  [5] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 11.17 h [6]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. 5.0 5.1 5.2 5.3 5.4 5.5 5.6 5.7 5.8 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  6. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]