From AureoWiki
Revision as of 06:50, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
Jump to navigation Jump to search

NCBI date : _

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1499 [new locus tag: SACOL_RS07635 ]
  • pan locus tag?: SAUPAN003919000
  • symbol: SACOL1499
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1499 [new locus tag: SACOL_RS07635 ]
  • symbol: SACOL1499
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1540854..1541171
  • length: 318
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 3237635 NCBI
  • RefSeq: YP_186343 NCBI

⊟Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAATCAATGGTAGAAATGCAACGTGAAGTTGATGAATATATTGGACAATTTAAAACA
    GGATATTTTTCACCATTAGCTAACTTAGCTAGATTGACTGAAGAAGTGGGCGAACTTGCA
    CGTGAAATAAATCATACCTATGGTGAAAAAAAGAAGAAAGATTCAGAGGAAGCAAATACG
    ATTAAAGCAGAATTAGGTGATAATTTATTTGTGTTGTTATGTTTAGCGAATTCAATGGGA
    ATAGATATGACAGAGAGCTTTAATGAAACAATGGAAAAGTTTAATACAAGAGATAAAAAT
    CGATTCGAAAGAAAGTGA
    60
    120
    180
    240
    300
    318

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1499 [new locus tag: SACOL_RS07635 ]
  • symbol: SACOL1499
  • description: hypothetical protein
  • length: 105
  • theoretical pI: 4.81549
  • theoretical MW: 12194.7
  • GRAVY: -0.766667

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function General MazG family protein (TIGR00444; HMM-score: 25.4)
  • TheSEED  :
    • Uncharacterized protein YpjD
  • PFAM:
    MazG (CL0231) MazG; MazG nucleotide pyrophosphohydrolase domain (PF03819; HMM-score: 77.7)
    and 3 more
    dUTPase_2; dUTPase (PF08761; HMM-score: 22.9)
    PRA-PH; Phosphoribosyl-ATP pyrophosphohydrolase (PF01503; HMM-score: 18)
    MazG-like; MazG-like family (PF12643; HMM-score: 14.4)

⊟Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008515
    • TAT(Tat/SPI): 0.000596
    • LIPO(Sec/SPII): 0.001447
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 57650414 NCBI
  • UniProt: A0A0H2WWC9 UniProt
  • protein Genbank : _
  • RefSeq: YP_186343 NCBI

⊟Protein sequence[edit | edit source]

  • MKSMVEMQREVDEYIGQFKTGYFSPLANLARLTEEVGELAREINHTYGEKKKKDSEEANTIKAELGDNLFVLLCLANSMGIDMTESFNETMEKFNTRDKNRFERK

⊟Peptides[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Stability[edit | edit source]

  • half-life: 15.93 h [1]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1499&oldid=88370"