Jump to navigation
Jump to search
m (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism") |
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
||
Line 101: | Line 101: | ||
* <aureodatabase>protein GI</aureodatabase> | * <aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein UniProt</aureodatabase> | * <aureodatabase>protein UniProt</aureodatabase> | ||
* <aureodatabase>protein RefSeq</aureodatabase> | * <aureodatabase>protein RefSeq</aureodatabase> | ||
</protect> | </protect> |
Revision as of 20:52, 10 March 2016
NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1446 [new locus tag: SACOL_RS07375 ]
- pan locus tag?: SAUPAN003828000
- symbol: SACOL1446
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1446 [new locus tag: SACOL_RS07375 ]
- symbol: SACOL1446
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1458070..1458273
- length: 204
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238281 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTACATGAAACTTGGAAAGAACGTACACCAATCAAGAAAGTAGAAGTCATTAATACA
GATGCAAAGAAATTTACAGTTTCTGACATGTTAACGGTTGGCAAACAATATGATGTTATC
AACGAAACTGAAGAATATTATCAAATAATAGATAATTCTGGATTAGTTGGCGGTTACTAT
AAAACATATTTCAAAGAAGTTTAA60
120
180
204
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1446 [new locus tag: SACOL_RS07375 ]
- symbol: SACOL1446
- description: hypothetical protein
- length: 67
- theoretical pI: 5.03651
- theoretical MW: 7898.92
- GRAVY: -0.579104
⊟Function[edit | edit source]
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006909
- TAT(Tat/SPI): 0.000244
- LIPO(Sec/SPII): 0.002285
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLHETWKERTPIKKVEVINTDAKKFTVSDMLTVGKQYDVINETEEYYQIIDNSGLVGGYYKTYFKEV
⊟Peptides[edit | edit source]
- experimentally validated: data available for NCTC8325
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: 14.73 h [1]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)