From AureoWiki
Revision as of 12:46, 12 January 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism")
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1439 [new locus tag: SACOL_RS07335 ]
  • symbol: SACOL1439
  • product: acylphosphatase
  • replicon: chromosome
  • strand: +
  • coordinates: 1450532..1450801
  • length: 270
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID: 3236547 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGACATATACATTTACAAGTATTCGGACGCGTTCAAGGCGTCGGATTTAGATATTTT
    ACACAACGCATTGCAATGAACTATAACATTGTCGGTACTGTTCAAAATGTAGATGACTAT
    GTAGAGATATATGCACAAGGGGATGACGCAGATATAGAGAGATTTATTCAAGGTGTAATT
    GAAGGTGCCTCACCAGCATCAAATGTAACAAGCCATCAACTTGAAGAGTTAGAACTAAAT
    CAAAAATTATCGGATTTTCGATCAATATAA
    60
    120
    180
    240
    270

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1439 [new locus tag: SACOL_RS07335 ]
  • symbol: SACOL1439
  • description: acylphosphatase
  • length: 89
  • theoretical pI: 4.71273
  • theoretical MW: 10160.3
  • GRAVY: -0.270787

Function[edit | edit source]

  • reaction:
    EC 3.6.1.7?  ExPASy
    Acylphosphatase An acylphosphate + H2O = a carboxylate + phosphate
  • TIGRFAM:
    Genetic information processing Protein fate Protein modification and repair carbamoyltransferase HypF (TIGR00143; HMM-score: 50.2)
  • TheSEED  :
    • Acylphosphate phosphohydrolase (EC 3.6.1.7)
    Carbohydrates Central carbohydrate metabolism Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate  Acylphosphate phosphohydrolase (EC 3.6.1.7), putative
  • PFAM:
    Acylphosphatase (CL0622) Acylphosphatase; Acylphosphatase (PF00708; HMM-score: 80.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011045
    • TAT(Tat/SPI): 0.000551
    • LIPO(Sec/SPII): 0.001518
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 57651904 NCBI
  • UniProt: Q5HG16 UniProt
  • protein Genbank : _
  • RefSeq: YP_186291 NCBI

Protein sequence[edit | edit source]

  • MRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQGVIEGASPASNVTSHQLEELELNQKLSDFRSI

Peptides[edit | edit source]

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: 191.11 h [1]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]