From AureoWiki
Jump to navigation Jump to search
VisualWikitext
(Created page with "<protect> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aureodatabase> * <aureodatabase>gene symbol</...")
 
m (Text replacement - "title=SACOL0100" to "title={{PAGENAMEE}}")
Line 43: Line 43:
==Phenotype==
==Phenotype==
</protect>
</protect>
* Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title=SACOL0100&action=edit&section=6 edit]</span>]
* Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title={{PAGENAMEE}}&action=edit&section=6 edit]</span>]


<protect>
<protect>

Revision as of 15:01, 28 October 2014

PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1356
  • pan locus tag?: SAUPAN003693000
  • symbol: SACOL1356
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1356
  • symbol: SACOL1356
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1362963..1363070
  • length: 108
  • essential: unknown

⊟Accession numbers[edit | edit source]

  • Gene ID: 3237568 NCBI
  • gene Genbank : _

⊟Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    GTGACTGTATTTTCATTTGAAATGTTCATTTATTTTCACTCCTTAACAATAACATTATAT
    CATGCTATAGCTTTCCAAAATATTGAAATATGTAGATATGGCTATTGA
    60
    108

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1356
  • symbol: SACOL1356
  • description: hypothetical protein
  • length: 35
  • theoretical pI: 6.49206
  • theoretical MW: 4270.97
  • GRAVY: 0.685714

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:

⊟Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.176988
    • TAT(Tat/SPI): 0.007009
    • LIPO(Sec/SPII): 0.050348
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 57650325 NCBI
  • UniProt: A0A0H2WX14 UniProt
  • protein Genbank : _
  • RefSeq: YP_186209 NCBI

⊟Protein sequence[edit | edit source]

  • MTVFSFEMFIYFHSLTITLYHAIAFQNIEICRYGY

⊟Peptides[edit | edit source]

  • experimentally validated:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1356&oldid=14132"