NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1067 [new locus tag: SACOL_RS05440 ]
- pan locus tag?: SAUPAN003267000
- symbol: qoxD
- pan gene symbol?: qoxD
- synonym:
- product: quinol oxidase subunit IV
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1067 [new locus tag: SACOL_RS05440 ]
- symbol: qoxD
- product: quinol oxidase subunit IV
- replicon: chromosome
- strand: -
- coordinates: 1076196..1076474
- length: 279
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238089 NCBI
- RefSeq: YP_185931 NCBI
- BioCyc: see SACOL_RS05440
- MicrobesOnline: 912535 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAACATACTGTAGGATTTATCGCATCTATCGTATTAACGCTTTTAGCAGTTTACGTA
ACACTATACACGTCATTAACATTCCACGCGAAGTTGACAATTATCTTTGGCTTTGCATTC
GTCCAAGCAGGACTTCAATTATTAATGTTCATGCATTTAACTGAAGGTAAAGATGGACGT
TTACAAACATTCAAAGTTATCTTTGCTCTTGTAATTACACTTTGTTTCGTTGTCGGAACA
TATTGGGTTATGCAAGGCGGTCACTCTTCACACTTATAA60
120
180
240
279
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1067 [new locus tag: SACOL_RS05440 ]
- symbol: QoxD
- description: quinol oxidase subunit IV
- length: 92
- theoretical pI: 9.69391
- theoretical MW: 10254.3
- GRAVY: 1.01087
⊟Function[edit | edit source]
- reaction: EC 1.9.3.-? ExPASyEC 1.10.3.-? ExPASy2 a quinol + O2 = 2 a quinone + 2 H2O?
- TIGRFAM: Energy metabolism Electron transport cytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104)and 3 moreEnergy metabolism Electron transport cytochrome o ubiquinol oxidase subunit IV (TIGR02847; EC 1.10.3.-; HMM-score: 55.7)Energy metabolism Electron transport caa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 17.7)Energy metabolism Electron transport cytochrome c oxidase, subunit IVB (TIGR02908; EC 1.9.3.1; HMM-score: 14.6)
- TheSEED :
- AA3-600 quinol oxidase subunit IV
- PFAM: no clan defined COX4_pro; Prokaryotic Cytochrome C oxidase subunit IV (PF03626; HMM-score: 45.7)and 2 moreDUF2417; Region of unknown function (DUF2417) (PF10329; HMM-score: 11.5)Yip1 (CL0112) DUF1700; Protein of unknown function (DUF1700) (PF08006; HMM-score: 10.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014241
- TAT(Tat/SPI): 0.000346
- LIPO(Sec/SPII): 0.004461
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEGKDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: Integral membrane [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: qoxD < qoxC < qoxA < qoxB
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e)