NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1020 [new locus tag: SACOL_RS05205 ]
- pan locus tag?: SAUPAN003192000
- symbol: SACOL1020
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1020 [new locus tag: SACOL_RS05205 ]
- symbol: SACOL1020
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1028695..1029204
- length: 510
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237751 NCBI
- RefSeq: YP_185886 NCBI
- BioCyc: see SACOL_RS05205
- MicrobesOnline: 912488 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGATTTTAGGATTAGCATTAATTCCATCAAAGTCATTTCAAGAAGCGGTGGATTCTTAC
CGTAAAAGATATGATAAACAGTATTCACGAATTAAACCACATGTGACAATTAAAGCGCCA
TTTGAAATTAAAGATGGTGATTTAGATTCTGTCATTGAACAGGTTAGAGCTCGTATTAAT
GGTATACCAGCAGTAGAAGTTCATGCTACAAAAGCTTCTAGCTTCAAACCAACGAACAAT
GTGATTTACTTTAAAGTTGCGAAGACGGACGACTTAGAAGAATTGTTTAATCGCTTTAAT
GGAGAAGATTTCTATGGAGAAGCTGAACATGTTTTTGTGCCACACTTTACAATAGCACAA
GGACTATCTAGCCAAGAATTCGAAGATATTTTTGGTCAAGTAGCATTAGCTGGGGTAGAC
CATAAAGAAATTATCGATGAATTAACTTTGTTACGTTTTGACGATGACGAAGATAAATGG
AAAGTTATTGAAACGTTTAAATTAGCTTAA60
120
180
240
300
360
420
480
510
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1020 [new locus tag: SACOL_RS05205 ]
- symbol: SACOL1020
- description: hypothetical protein
- length: 169
- theoretical pI: 4.81578
- theoretical MW: 19325.7
- GRAVY: -0.313609
⊟Function[edit | edit source]
- reaction: EC 3.1.-.-? ExPASy
- TIGRFAM: Transcription RNA processing 2'-5' RNA ligase (TIGR02258; EC 6.5.1.-; HMM-score: 15.8)and 1 moreputative phosphonate metabolism protein (TIGR03223; HMM-score: 12.5)
- TheSEED :
- 2H phosphoesterase superfamily protein Bsu1186 (yjcG)
- PFAM: 2H (CL0247) 2_5_RNA_ligase2; 2'-5' RNA ligase superfamily (PF13563; HMM-score: 71)and 3 moreLigT_PEase; LigT like Phosphoesterase (PF02834; HMM-score: 44.2)CPDase; Cyclic phosphodiesterase-like protein (PF07823; HMM-score: 17.8)no clan defined Vps16_C; Vps16, C-terminal region (PF04840; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.83
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013851
- TAT(Tat/SPI): 0.001013
- LIPO(Sec/SPII): 0.001567
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIKDGDLDSVIEQVRARINGIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQGLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 1074 [5]
- interaction partners:
SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [6] (data from MRSA252) SACOL0877 (gcvH) glycine cleavage system protein H [6] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [6] (data from MRSA252) SACOL1104 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 [6] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [6] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [6] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [6] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [6] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [6] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [6] (data from MRSA252) SACOL1448 (sucB) dihydrolipoamide succinyltransferase [6] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [6] (data from MRSA252) SACOL2173 alkaline shock protein 23 [6] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CcpA regulon
CcpA (TF) important in Carbon catabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 6.00 6.01 6.02 6.03 6.04 6.05 6.06 6.07 6.08 6.09 6.10 6.11 6.12 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)