NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0953 [new locus tag: SACOL_RS04885 ]
- pan locus tag?: SAUPAN003051000
- symbol: mnhC
- pan gene symbol?: mnhC1
- synonym:
- product: monovalent cation/H+ antiporter subunit C
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0953 [new locus tag: SACOL_RS04885 ]
- symbol: mnhC
- product: monovalent cation/H+ antiporter subunit C
- replicon: chromosome
- strand: -
- coordinates: 954401..954742
- length: 342
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237714 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301GTGGAAATTATTATGATTTTTGTTAGTGGTATTCTCACAGCAATTAGTGTCTATCTCGTT
TTGTCTAAAAGTCTGATACGAATTGTTATGGGAACTACACTATTAACACATGCAGCAAAT
TTATTTTTAATAACTATGGGCGGACTTAAACATGGTACTGTTCCAATTTATGAAGCGAAC
GTAAAAAGCTATGTTGATCCTATCCCGCAAGCACTTATTTTAACAGCAATCGTTATCGCC
TTTGCGACAACAGCCTTTTTCTTAGTATTAGCATTTAGAACATATAAAGAATTAGGCACA
GATAACGTTGAGAGTATGAAAGGAGTTCCAGAAGATGATTGA60
120
180
240
300
342
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0953 [new locus tag: SACOL_RS04885 ]
- symbol: MnhC
- description: monovalent cation/H+ antiporter subunit C
- length: 113
- theoretical pI: 5.61663
- theoretical MW: 12292.6
- GRAVY: 0.839823
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 175.7)
- TheSEED :
- Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3)
- PFAM: no clan defined Oxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 110.6)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.133377
- TAT(Tat/SPI): 0.003616
- LIPO(Sec/SPII): 0.004539
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD
⊟Peptides[edit | edit source]
- experimentally validated: data available for NCTC8325
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.