From AureoWiki
Revision as of 01:33, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0950 [new locus tag: SACOL_RS04870 ]
  • symbol: mnhF
  • product: monovalent cation/H+ antiporter subunit F
  • replicon: chromosome
  • strand: -
  • coordinates: 952138..952431
  • length: 294
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID: 3237711 NCBI
  • RefSeq: YP_185819 NCBI

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAATCATAATGTTATTATCGTTATTGCATTAATCATAGTTGTCATTTCTATGTTAGCT
    ATGCTCATTCGCGTTGTGCTAGGCCCATCACTTGCCGATCGTGTTGTCGCATTAGATGCG
    ATTGGTCTTCAATTAATGGCAGTTATAGCATTATTCAGTATTTTATTAAATATTAAATAC
    ATGATTGTCGTTATTATGATGATTGGTATATTAGCTTTTTTAGGTACTGCAGTATTCTCT
    AAATTTATGGACAAAGGTAAGGTGATTGAACATGATCAAAATCATACTGATTAG
    60
    120
    180
    240
    294

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0950 [new locus tag: SACOL_RS04870 ]
  • symbol: MnhF
  • description: monovalent cation/H+ antiporter subunit F
  • length: 97
  • theoretical pI: 7.7971
  • theoretical MW: 10616.1
  • GRAVY: 1.3701

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 9.9)
    and 1 more
    TIGR03943 family protein (TIGR03943; HMM-score: 6.5)
  • TheSEED  :
    • Na(+) H(+) antiporter subunit F (TC 2.A.63.1.3)
    Membrane Transport Uni- Sym- and Antiporters Sodium Hydrogen Antiporter  Na(+) H(+) antiporter subunit F (TC 2.A.63.1.3)
  • PFAM:
    no clan defined MrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 49.9)
    and 2 more
    ABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 14.5)
    no clan defined Deltameth_res; Deltamethrin resistance (PF16020; HMM-score: 6.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.033588
    • TAT(Tat/SPI): 0.000316
    • LIPO(Sec/SPII): 0.021791
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

  • GI: 57651638 NCBI
  • UniProt: Q5HHD8 UniProt
  • protein Genbank : _
  • RefSeq: YP_185819 NCBI

Protein sequence[edit | edit source]

  • MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKYMIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD

Peptides[edit | edit source]

  • experimentally validated:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]