From AureoWiki
Revision as of 23:57, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0943 [new locus tag: SACOL_RS04835 ]
  • symbol: SACOL0943
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 944598..944957
  • length: 360
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID: 3237739 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCCAACAGTTATATTAACAGAAGCAGCTGCTTACGAAGTAAAAGATATGCTTAAAGCA
    AATGAAATGCCAGATGGCTATTTAAAAATTAAAGTGAATGGTGGCGGGTGCACTGGTTTA
    ACATACGGTATGGGTGCAGAAGAAGCGCCTGGTGAAAATGATGAAGTCTTAGAATACTTT
    GGATTAAAAGTATTAGTAGACAAAAAAGATGCACCCGTATTAAATGGTACGACTATTGAT
    TTTAAGCAATCATTAATGGGTGGCGGTTTCCAAATCGACAATCCTAATGCAATTGCTTCA
    TGTGGCTGTGGTAGTTCATTTAGAACTGCAAAAGTTGCAGGTAATCCTGAAAATTGCTAA
    60
    120
    180
    240
    300
    360

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0943 [new locus tag: SACOL_RS04835 ]
  • symbol: SACOL0943
  • description: hypothetical protein
  • length: 119
  • theoretical pI: 4.25843
  • theoretical MW: 12485.1
  • GRAVY: -0.160504

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly accessory protein (TIGR00049; HMM-score: 112.5)
    and 4 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly scaffold SufA (TIGR01997; HMM-score: 82.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly protein IscA (TIGR02011; HMM-score: 69)
    Unknown function General HesB-like selenoprotein (TIGR01911; HMM-score: 41.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other IscR-regulated protein YhgI (TIGR03341; HMM-score: 29)
  • TheSEED  :
    • Probable iron-binding protein from the HesB_IscA_SufA family
  • PFAM:
    no clan defined Fe-S_biosyn; Iron-sulphur cluster biosynthesis (PF01521; HMM-score: 63.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.83
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.123965
    • TAT(Tat/SPI): 0.000728
    • LIPO(Sec/SPII): 0.004207
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYFGLKVLVDKKDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPENC

Peptides[edit | edit source]

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]