⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0865 [new locus tag: SACOL_RS04445 ]
- pan locus tag?: SAUPAN002807000
- symbol: SACOL0865
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0865 [new locus tag: SACOL_RS04445 ]
- symbol: SACOL0865
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 891075..891335
- length: 261
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238453 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATAACATTTTGTTAAATGCTATCAATATAGTTATTACTACCACTTTTGTTATCTTT
AATATTTTAATCACATATAATAAAGATTTAGATGATTTATGTTGGCTCCTGCCTGGTATT
ATCATTTGTGGTGTGATACTCATCGTATCCTTTACCATTGCAATGATAACTAAAAACTGG
TTAAGTGAAATATTATTTTTTATAAATATCGTACTCGTTCTCTATTACATTTATCCTATT
TTTTATAGTTTTATAGGTTAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0865 [new locus tag: SACOL_RS04445 ]
- symbol: SACOL0865
- description: hypothetical protein
- length: 86
- theoretical pI: 4.06264
- theoretical MW: 9940.02
- GRAVY: 1.43837
⊟Function[edit | edit source]
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001759
- TAT(Tat/SPI): 0.000058
- LIPO(Sec/SPII): 0.00567
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPIFYSFIG
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.