From AureoWiki
Revision as of 20:19, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0560 [new locus tag: SACOL_RS02865 ]
  • pan locus tag?: SAUPAN002258000
  • symbol: folK
  • pan gene symbol?: folK
  • synonym:
  • product: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0560 [new locus tag: SACOL_RS02865 ]
  • symbol: folK
  • product: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase
  • replicon: chromosome
  • strand: +
  • coordinates: 569392..569868
  • length: 477
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGATTCAAGCATACTTAGGATTAGGTAGTAATATTGGTGATAGAGAAAGCCAGTTAAAC
    GATGCTATAAAGATTTTGAATGAATATGATGGTATTAACGTATCTAATATTTCTCCGATT
    TATGAAACAGCACCAGTTGGGTATACTGAGCAACCTAACTTTTTAAATTTGTGTGTTGAA
    ATTCAAACAACACTCACAGTATTACAACTGTTGGAATGTTGTTTGAAGACAGAAGAATGT
    TTACACCGTATTAGAAAGGAACGATGGGGTCCTAGAACTTTAGATGTGGATATTTTGTTG
    TATGGAGAAGAAATGATAGATTTACCAAAACTGTCGGTGCCACATCCGAGAATGAATGAA
    CGTGCATTTGTTTTAATCCCATTAAATGATATAGCAGCAAATGTCGTAGAACCACGTTCG
    AAATTGAAAGTGAAAGATTTAGTTTTTGTCGATGACAGTGTAAAGAGATATAAATAA
    60
    120
    180
    240
    300
    360
    420
    477

Protein[edit | edit source]

Protein Data Bank: 5ETQ
Protein Data Bank: 5ETR
Protein Data Bank: 5ETS
Protein Data Bank: 5ETT
Protein Data Bank: 5ETV

General[edit | edit source]

  • locus tag: SACOL0560 [new locus tag: SACOL_RS02865 ]
  • symbol: FolK
  • description: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase
  • length: 158
  • theoretical pI: 4.84673
  • theoretical MW: 18028.8
  • GRAVY: -0.149367

Function[edit | edit source]

  • reaction:
    EC 2.7.6.3?  ExPASy
    2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase ATP + 6-hydroxymethyl-7,8-dihydropterin = AMP + 6-hydroxymethyl-7,8-dihydropterin diphosphate
  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Folic acid 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (TIGR01498; EC 2.7.6.3; HMM-score: 150.3)
  • TheSEED  :
    • 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)
    Cofactors, Vitamins, Prosthetic Groups, Pigments Folate and pterines Folate Biosynthesis  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)
  • PFAM:
    no clan defined HPPK; 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) (PF01288; HMM-score: 125.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006796
    • TAT(Tat/SPI): 0.000391
    • LIPO(Sec/SPII): 0.001991
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIQAYLGLGSNIGDRESQLNDAIKILNEYDGINVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell:
  • interaction partners:
    SACOL0731LysR family transcriptional regulator  [4] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]