NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0388 [new locus tag: SACOL_RS01950 ]
- pan locus tag?: SAUPAN001627000
- symbol: SACOL0388
- pan gene symbol?: —
- synonym:
- product: prophage L54a, holin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0388 [new locus tag: SACOL_RS01950 ]
- symbol: SACOL0388
- product: prophage L54a, holin
- replicon: chromosome
- strand: +
- coordinates: 395748..396050
- length: 303
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236631 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGATGCAAAAGTAATAACAAGATACATCGTATTGATCTTAGCATTAGTAAATCAATTC
TTAGCGAATAAAGGTATAAGTCCGATACCAGTAGATGAAGAAAGTGTTTCATCGATTATC
TTAACAGTTGTTGCTTTATATACTACATATAAAGATAATCCAACATCTCAAGAAGGGAAA
TGGGCGAATCAAAAATTAAAGAAATATAAAGCTGAAAGTAAATATAGAAAAGCAACAGGA
CAAGCACCTATTAAAGAAGTAATGACACCTACGAATATGAACGACACAAATGATTTAGGG
TAG60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0388 [new locus tag: SACOL_RS01950 ]
- symbol: SACOL0388
- description: prophage L54a, holin
- length: 100
- theoretical pI: 9.66058
- theoretical MW: 11133.8
- GRAVY: -0.306
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions holin, SPP1 family (TIGR01592; HMM-score: 101.5)
- TheSEED :
- Phage holin
- PFAM: no clan defined Holin_SPP1; SPP1 phage holin (PF04688; HMM-score: 49)and 2 moreTurandot; Stress-inducible humoral factor Turandot (PF07240; HMM-score: 12.8)DUF3783; Domain of unknown function (DUF3783) (PF12646; HMM-score: 11.8)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.5
- Signal peptide possibility: 0
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.387011
- TAT(Tat/SPI): 0.003022
- LIPO(Sec/SPII): 0.037432
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGKWANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.