From AureoWiki
Revision as of 06:57, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0365 [new locus tag: SACOL_RS01835 ]
  • pan locus tag?: SAUPAN001836000
  • symbol: SACOL0365
  • pan gene symbol?:
  • synonym:
  • product: prophage L54a, HNH endonuclease

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0365 [new locus tag: SACOL_RS01835 ]
  • symbol: SACOL0365
  • product: prophage L54a, HNH endonuclease
  • replicon: chromosome
  • strand: +
  • coordinates: 373489..373803
  • length: 315
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACCAAGCACAATAACATTTATAAGCATGGTCGTAAGTCATATCAATACGATTGGTTC
    TATCATTCAAAAGCATGGAAGAAGTTAAGAGAGATAGCATTAGATAGAGATAATTATCTT
    TGTCAAATGTGTTTACGCGAAGATATTATAACAGATGCAAAGATTGTGCATCACATTATT
    TATGTTGATGAAGATTTTAACAAAGCTTTAGACTTAGATAATCTAATGTCAGTTTGTTAT
    AGCTGTCATAACAAAATTCATGCAAATGATAATGACAAAAGTAATCTTAAGAAAATTAGA
    GTTCTAAAAATTTAA
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0365 [new locus tag: SACOL_RS01835 ]
  • symbol: SACOL0365
  • description: prophage L54a, HNH endonuclease
  • length: 104
  • theoretical pI: 8.87913
  • theoretical MW: 12573.4
  • GRAVY: -0.706731

Function[edit | edit source]

  • TIGRFAM:
    decaheme c-type cytochrome, DmsE family (TIGR03508; HMM-score: 14.5)
  • TheSEED  :
    • Phage HNH endonuclease
  • PFAM:
    His-Me_finger (CL0263) HNH; HNH endonuclease (PF01844; HMM-score: 52.1)
    and 3 more
    no clan defined DUF4428; Domain of unknown function (DUF4428) (PF14471; HMM-score: 18.1)
    Multiheme_cytos (CL0317) Cytochrome_C7; Cytochrome c7 and related cytochrome c (PF14522; HMM-score: 14.3)
    Zn_Beta_Ribbon (CL0167) DZR; Double zinc ribbon (PF12773; HMM-score: 13)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003827
    • TAT(Tat/SPI): 0.000163
    • LIPO(Sec/SPII): 0.000613
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTKHNNIYKHGRKSYQYDWFYHSKAWKKLREIALDRDNYLCQMCLREDIITDAKIVHHIIYVDEDFNKALDLDNLMSVCYSCHNKIHANDNDKSNLKKIRVLKI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]