NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0365 [new locus tag: SACOL_RS01835 ]
- pan locus tag?: SAUPAN001836000
- symbol: SACOL0365
- pan gene symbol?: —
- synonym:
- product: prophage L54a, HNH endonuclease
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0365 [new locus tag: SACOL_RS01835 ]
- symbol: SACOL0365
- product: prophage L54a, HNH endonuclease
- replicon: chromosome
- strand: +
- coordinates: 373489..373803
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236794 NCBI
- RefSeq: YP_185257 NCBI
- BioCyc: see SACOL_RS01835
- MicrobesOnline: 911836 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACCAAGCACAATAACATTTATAAGCATGGTCGTAAGTCATATCAATACGATTGGTTC
TATCATTCAAAAGCATGGAAGAAGTTAAGAGAGATAGCATTAGATAGAGATAATTATCTT
TGTCAAATGTGTTTACGCGAAGATATTATAACAGATGCAAAGATTGTGCATCACATTATT
TATGTTGATGAAGATTTTAACAAAGCTTTAGACTTAGATAATCTAATGTCAGTTTGTTAT
AGCTGTCATAACAAAATTCATGCAAATGATAATGACAAAAGTAATCTTAAGAAAATTAGA
GTTCTAAAAATTTAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0365 [new locus tag: SACOL_RS01835 ]
- symbol: SACOL0365
- description: prophage L54a, HNH endonuclease
- length: 104
- theoretical pI: 8.87913
- theoretical MW: 12573.4
- GRAVY: -0.706731
⊟Function[edit | edit source]
- TIGRFAM: decaheme c-type cytochrome, DmsE family (TIGR03508; HMM-score: 14.5)
- TheSEED :
- Phage HNH endonuclease
- PFAM: His-Me_finger (CL0263) HNH; HNH endonuclease (PF01844; HMM-score: 52.1)and 3 moreno clan defined DUF4428; Domain of unknown function (DUF4428) (PF14471; HMM-score: 18.1)Multiheme_cytos (CL0317) Cytochrome_C7; Cytochrome c7 and related cytochrome c (PF14522; HMM-score: 14.3)Zn_Beta_Ribbon (CL0167) DZR; Double zinc ribbon (PF12773; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003827
- TAT(Tat/SPI): 0.000163
- LIPO(Sec/SPII): 0.000613
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKHNNIYKHGRKSYQYDWFYHSKAWKKLREIALDRDNYLCQMCLREDIITDAKIVHHIIYVDEDFNKALDLDNLMSVCYSCHNKIHANDNDKSNLKKIRVLKI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.