Jump to navigation
Jump to search
(Created page with "<protect> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aureodatabase> * <aureodatabase>gene symbol</...") |
m (Text replacement - "title=SACOL0100" to "title={{PAGENAMEE}}") |
||
Line 43: | Line 43: | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
* Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title= | * Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title={{PAGENAMEE}}&action=edit§ion=6 edit]</span>] | ||
<protect> | <protect> |
Revision as of 17:45, 28 October 2014
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0358 [new locus tag: SACOL_RS01800 ]
- pan locus tag?: SAUPAN001475000
- symbol: SACOL0358
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0358 [new locus tag: SACOL_RS01800 ]
- symbol: SACOL0358
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 371565..371771
- length: 207
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236925 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGACGCAATACTTAGTCACAACATTCAAAGATTCAACAGGACTACCACATGAACATATT
ACTGTGGCTAGAGATAATCAGACGTTTACAGTTGTTGAGGCAGAGAATAAAGAAGAAGCA
AAAGAGAAGTATGAGGCACAAGTTAAAAGGGATGCAATTATTAAAGCGAGTCAGTTGTTT
GAAAATATAAGGGAGTGTGGGAAATGA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0358 [new locus tag: SACOL_RS01800 ]
- symbol: SACOL0358
- description: hypothetical protein
- length: 68
- theoretical pI: 5.6988
- theoretical MW: 7829.74
- GRAVY: -0.752941
⊟Function[edit | edit source]
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008112
- TAT(Tat/SPI): 0.000407
- LIPO(Sec/SPII): 0.002225
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTQYLVTTFKDSTGLPHEHITVARDNQTFTVVEAENKEEAKEKYEAQVKRDAIIKASQLFENIRECGK
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.