From AureoWiki
Revision as of 11:03, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0355 [new locus tag: SACOL_RS01785 ]
  • pan locus tag?:
  • symbol: SACOL0355
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0355 [new locus tag: SACOL_RS01785 ]
  • symbol: SACOL0355
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 370444..370752
  • length: 309
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACGTTCACCTTATCAGATGAACAATATAAAAATCTTTGTACTAACTCTAACAAGTTA
    TTAGATAAACTTCACAAAGCATTAAAAGATCGTGAAGAGTACAAGAAGCAACGAGATGAG
    CTTATTGGGGATATAGCGAAGTTACGAGATTGTAACAAAGAACTGGAGAAGAAAGCAAGC
    GCATGGGATAGGTATTGCAAGAGCGTTGAAAAAGATTTAATAAACGAATTCGGTAACGAT
    GATGAAAGAGTTAAATTCGGAATGGAATTAAACAATAAAATTTTTATGGAGGATGACACA
    AATGAATAA
    60
    120
    180
    240
    300
    309

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0355 [new locus tag: SACOL_RS01785 ]
  • symbol: SACOL0355
  • description: hypothetical protein
  • length: 102
  • theoretical pI: 4.85853
  • theoretical MW: 12143.6
  • GRAVY: -1.16569

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Hypothetical protein, SAB1734c homolog [SA bacteriophages 11, Mu50B]
  • PFAM:
    no clan defined BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 19.7)
    and 6 more
    LOH1CR12; Tumour suppressor protein (PF10158; HMM-score: 14.8)
    NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 14.5)
    CENP-H; Centromere protein H (CENP-H) (PF05837; HMM-score: 14.4)
    Peptidase_MA (CL0126) Peptidase_M3; Peptidase family M3 (PF01432; HMM-score: 14)
    no clan defined MCU; Mitochondrial calcium uniporter (PF04678; HMM-score: 12.4)
    DUF2330; Uncharacterized protein conserved in bacteria (DUF2330) (PF10092; HMM-score: 11.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005526
    • TAT(Tat/SPI): 0.000572
    • LIPO(Sec/SPII): 0.001264
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTFTLSDEQYKNLCTNSNKLLDKLHKALKDREEYKKQRDELIGDIAKLRDCNKELEKKASAWDRYCKSVEKDLINEFGNDDERVKFGMELNNKIFMEDDTNE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]