From AureoWiki
Revision as of 07:10, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0322 [new locus tag: SACOL_RS01625 ]
  • pan locus tag?: SAUPAN001422000
  • symbol: SACOL0322
  • pan gene symbol?:
  • synonym:
  • product: prophage L54a, Cro-like protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0322 [new locus tag: SACOL_RS01625 ]
  • symbol: SACOL0322
  • product: prophage L54a, Cro-like protein
  • replicon: chromosome
  • strand: +
  • coordinates: 358218..358436
  • length: 219
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGCAATGGAATTTAATAAAGTTGAGAAAAGAAAGAAAGTGTACTCAAGAAGATTTAGCA
    AACCTCTTGAATATATCAACTGAAGGTTATCGTTTAAAAGAATTAGGAAAGCATCAATTT
    AAGAATGATGAGATGTTTATTATCGCTGATTTTTTTGACGAAAATATTGGAGATATTTTT
    TTACCCACAAAGTACACGAAACGCAAACGAACATCTTAA
    60
    120
    180
    219

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0322 [new locus tag: SACOL_RS01625 ]
  • symbol: SACOL0322
  • description: prophage L54a, Cro-like protein
  • length: 72
  • theoretical pI: 9.65905
  • theoretical MW: 8682.97
  • GRAVY: -0.797222

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 17.6)
  • TheSEED: data available for NCTC8325
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 23.8)
    and 5 more
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 18.7)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.7)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 14.8)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.8)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 12)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002243
    • TAT(Tat/SPI): 0.000162
    • LIPO(Sec/SPII): 0.000522
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MQWNLIKLRKERKCTQEDLANLLNISTEGYRLKELGKHQFKNDEMFIIADFFDENIGDIFLPTKYTKRKRTS

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]