NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0306 [new locus tag: SACOL_RS01545 ]
- pan locus tag?: SAUPAN001231000
- symbol: SACOL0306
- pan gene symbol?: —
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0306 [new locus tag: SACOL_RS01545 ]
- symbol: SACOL0306
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 339934..340611
- length: 678
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236951 NCBI
- RefSeq: YP_185198 NCBI
- BioCyc: see SACOL_RS01545
- MicrobesOnline: 911777 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGTTGAAATTTGAAAATGTAACAAAGTCATTTAAAGATGGGAATCGTAACATTGAAGCG
GTTAAAGATACAAATTTTGAGATAAATAAAGGTGATATTATAGCATTGGTTGGACCTTCT
GGCTCTGGTAAAAGTACATTTCTAACTATGGCAGGTGCTTTACAAACACCGACATCTGGG
CACATTTTAATCAATAACCAAGATATTACGACAATGAAGCAAAAAGCATTGGCAAAAGTT
AGAATGTCTGAAATAGGTTTTATTTTACAAGCTACAAACCTTGTACCATTTTTAACGGTA
AAGCAACAATTTACATTATTGAAAAAGAAAAATAAGAATGTTATGTCTAATGAAGACTAT
CAGCAACTTATGTCACAATTAGGTCTAACTTCATTGCTTAATAAGTTACCTTCAGAAATT
TCAGGTGGTCAGAAACAACGTGTGGCGATAGCCAAAGCGTTATATACGAATCCGTCGATT
ATTTTAGCGGATGAACCTACCGCGGCGTTAGATACTGAAAATGCGATTGAAGTCATTAAA
ATTCTACGTGATCAAGCCAAACAAAGAAAGAAAGCATGTATTATTGTTACACATGATGAA
CGACTTAAAGCATATTGTGATCGTTCATATCATATGAAAGATGGCGTCCTTAATCTTGAA
AATGAAACAGTAGAATAG60
120
180
240
300
360
420
480
540
600
660
678
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0306 [new locus tag: SACOL_RS01545 ]
- symbol: SACOL0306
- description: ABC transporter ATP-binding protein
- length: 225
- theoretical pI: 9.75699
- theoretical MW: 24982.8
- GRAVY: -0.298222
⊟Function[edit | edit source]
- TIGRFAM: ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 200.5)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 196.1)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 177.3)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 177.3)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 162)and 72 moreCellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 155.7)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 145.8)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 144.5)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 140.6)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 139.5)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 138)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 137.7)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 130.6)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 128.6)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 124.7)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 123.4)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 118.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 118.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 118.2)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 116.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 116.6)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 116.6)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 112.9)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 108.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 108.5)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 107.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 105.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 104.5)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 104.5)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 103.7)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 103.7)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 100.6)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.4)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.4)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 100.2)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 99.6)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 98.8)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 98.7)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 98.6)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 98)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 95.7)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 93.8)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 93.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 93.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 93.4)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 92.3)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.3)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.3)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 86.6)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 84.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 78.1)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 77.5)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 77.5)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 77.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 76.9)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 74.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 73)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 70.2)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 70.2)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 69.4)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 62.8)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.5)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 49.7)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 49.7)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 49)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 43.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 41.3)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 37)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 32.2)rad50 (TIGR00606; HMM-score: 27.5)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 17.1)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 17.1)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 16.6)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 16.6)Transcription RNA processing polynucleotide kinase-phosphatase (TIGR04075; HMM-score: 11.7)
- TheSEED :
- ABC transporter ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113.3)and 19 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 35.5)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 30.9)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 23.8)AAA_15; AAA ATPase domain (PF13175; HMM-score: 22.4)IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 19.8)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.8)AAA_22; AAA domain (PF13401; HMM-score: 18.3)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 17)AAA_25; AAA domain (PF13481; HMM-score: 16.2)AAA_23; AAA domain (PF13476; HMM-score: 15.6)AAA_18; AAA domain (PF13238; HMM-score: 15.5)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 15.4)AAA_33; AAA domain (PF13671; HMM-score: 14.8)AAA_30; AAA domain (PF13604; HMM-score: 14.6)PhoH; PhoH-like protein (PF02562; HMM-score: 14.5)AAA_24; AAA domain (PF13479; HMM-score: 13.9)Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 13.5)PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 12.4)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 10.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.046607
- TAT(Tat/SPI): 0.014264
- LIPO(Sec/SPII): 0.00108
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKFENVTKSFKDGNRNIEAVKDTNFEINKGDIIALVGPSGSGKSTFLTMAGALQTPTSGHILINNQDITTMKQKALAKVRMSEIGFILQATNLVPFLTVKQQFTLLKKKNKNVMSNEDYQQLMSQLGLTSLLNKLPSEISGGQKQRVAIAKALYTNPSIILADEPTAALDTENAIEVIKILRDQAKQRKKACIIVTHDERLKAYCDRSYHMKDGVLNLENETVE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
SACOL2657 (arcA) arginine deiminase [3] (data from MRSA252) SACOL1734 (gapA2) glyceraldehyde 3-phosphate dehydrogenase 2 [3] (data from MRSA252) SACOL1477 (ilvA1) threonine dehydratase [3] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [3] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [3] (data from MRSA252) SACOL0564 pyridoxal biosynthesis lyase PdxS [3] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ 3.0 3.1 3.2 3.3 3.4 3.5 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p)