NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2419 [new locus tag: SA_RS13870 ]
- pan locus tag?: SAUPAN006340000
- symbol: SA2419
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2419 [new locus tag: SA_RS13870 ]
- symbol: SA2419
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2714613..2714813
- length: 201
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125348 NCBI
- RefSeq: NP_375745 NCBI
- BioCyc: see SA_RS13870
- MicrobesOnline: 104771 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATACTAGTAATGTTATCTCCATTATTAATCATATTCTTTATAGTGTTGTCTATTTTA
GAGGAGCGTAAACGTACGAAGAAAAAGCAACTCGAGAAAGAAAAAGCAAATACACTAAAT
CAAAATACAAATGACACGGAAAGTTCAAATCAAGAGCCGTCATTGCAGCAGACTAAAGAA
CAAAAAGATAACAAAGGATAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2419 [new locus tag: SA_RS13870 ]
- symbol: SA2419
- description: hypothetical protein
- length: 66
- theoretical pI: 9.91647
- theoretical MW: 7673.81
- GRAVY: -0.793939
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 13.9)Cellular processes Sporulation and germination stage III sporulation protein AF (TIGR02896; HMM-score: 13.5)and 1 moreTransport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 10.1)
- TheSEED :
- FIG01108353: hypothetical protein
- PFAM: no clan defined DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 21.7)DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 19.9)and 17 moreDi19_C; Stress-induced protein Di19, C-terminal (PF14571; HMM-score: 16.8)TMEM156; TMEM156 protein family (PF15106; HMM-score: 15.9)Cadherin_C_2; Cadherin cytoplasmic C-terminal (PF16492; HMM-score: 15.8)OSTbeta; Organic solute transporter subunit beta protein (PF15048; HMM-score: 15.4)Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 14.8)no clan defined EphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 14)YajC; Preprotein translocase subunit (PF02699; HMM-score: 13.4)DUF4725; Domain of unknown function (DUF4725) (PF15854; HMM-score: 13.1)GRP; Glycine rich protein family (PF07172; HMM-score: 13)Ctr; Ctr copper transporter family (PF04145; HMM-score: 12.9)Ninjurin; Ninjurin (PF04923; HMM-score: 12.6)CLN3; CLN3 protein (PF02487; HMM-score: 12.2)MotB_plug; Membrane MotB of proton-channel complex MotA/MotB (PF13677; HMM-score: 12.1)GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 11.4)7tm_1; 7 transmembrane receptor (rhodopsin family) (PF00001; HMM-score: 11.2)no clan defined OAD_gamma; Oxaloacetate decarboxylase, gamma chain (PF04277; HMM-score: 11.2)TMEM154; TMEM154 protein family (PF15102; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.266907
- TAT(Tat/SPI): 0.001814
- LIPO(Sec/SPII): 0.194897
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQTKEQKDNKG
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.