From AureoWiki
Revision as of 10:10, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2314 [new locus tag: SA_RS13265 ]
  • pan locus tag?: SAUPAN006176000
  • symbol: SA2314
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2314 [new locus tag: SA_RS13265 ]
  • symbol: SA2314
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2599352..2599987
  • length: 636
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAACTAAATAACTATTCTTTAAAAGTTAAAAACAAACAACTAGTTGACAATTGTGAT
    TTAAATTTCTATCTTGGTCAGATCAATCACATTGTTGGTAAAAATGGTGTAGGAAAATCT
    TTATTAGCTAAAGATTTCTTACTAAATAATAGTGGAAATATCCCTAAGTCCATTTCTCAA
    AATGTAACCTTAATATCAAGTTCATCAAATATTCCTAATGATATAACAAAAGATTTTTTA
    TTATCATTGTTAAAATCAAAATTTGAAAACAATCGACAAACATTCGATAAGATTTATAAC
    ATACTAAACATCGAAGCAATACCGTCTAACGTACTACTAAAAAACTTGAGTGATGGTCAA
    AAACAAAAGCTTAAATTATTAAGTTTCTTATTGGAAGATCATGATTTAATCATATTAGAT
    GAAGTTACAAACGCTTTAGACAAGAAAACAGTTAATGAAATTTATGAATTTTTAAATGAT
    TTTATTCAAAGCCATCAAACTAAAACTATTATCAATATTACACATAATTTATCCGATTTA
    AGTGCTTTGCCGGGTAAATACTTTATTTTTAAAGACCTTCAAATAGAAGAGTACCAATCA
    AAAGAAGAAGTCATAAATGATTACATTAATTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    636

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2314 [new locus tag: SA_RS13265 ]
  • symbol: SA2314
  • description: hypothetical protein
  • length: 211
  • theoretical pI: 6.52286
  • theoretical MW: 24107.4
  • GRAVY: -0.269668

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 69.3)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 61.9)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 58.3)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 58.3)
    and 66 more
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 51.7)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 46.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 46.6)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 46.6)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 45.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 44.5)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 44.5)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 44.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 44)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 43.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 43.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 42.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 42.2)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 41.7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 41.5)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 41.3)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 41.1)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 40.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 40.4)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 39.9)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 38.4)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 38.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 38.3)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 38)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 37.9)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 37.6)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 37.4)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 37.1)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 37.1)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 36.6)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 36.6)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 35.1)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 34.9)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 34.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 34.1)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 33.8)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 33.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 33.5)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 33.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 32.4)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 32.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 32)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 32)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 32)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 30.9)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 30.1)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 28.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 26.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 26.7)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 26.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 26.3)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 25.2)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 25.2)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 25.1)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 24)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 24)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 23.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 23.8)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 22.4)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 20.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 20)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 19.4)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 15.2)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 12.4)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 10.4)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 10.4)
  • TheSEED  :
    • ABC transporter, ATP-binding protein
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 51.3)
    and 13 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 37.9)
    AAA_22; AAA domain (PF13401; HMM-score: 31.3)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 22.3)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 20.5)
    ATPase; KaiC (PF06745; HMM-score: 16.1)
    HTH (CL0123) Tn7_Tnp_TnsA_C; TnsA endonuclease C terminal (PF08721; HMM-score: 15.6)
    P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.3)
    NACHT; NACHT domain (PF05729; HMM-score: 15.3)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 14)
    CobA_CobO_BtuR; ATP:corrinoid adenosyltransferase BtuR/CobO/CobP (PF02572; HMM-score: 13.8)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 13.1)
    IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 13.1)
    AAA_23; AAA domain (PF13476; HMM-score: 9.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.043186
    • TAT(Tat/SPI): 0.000318
    • LIPO(Sec/SPII): 0.000919
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKLNNYSLKVKNKQLVDNCDLNFYLGQINHIVGKNGVGKSLLAKDFLLNNSGNIPKSISQNVTLISSSSNIPNDITKDFLLSLLKSKFENNRQTFDKIYNILNIEAIPSNVLLKNLSDGQKQKLKLLSFLLEDHDLIILDEVTNALDKKTVNEIYEFLNDFIQSHQTKTIINITHNLSDLSALPGKYFIFKDLQIEEYQSKEEVINDYINL

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]