NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2058 [new locus tag: SA_RS11835 ]
- pan locus tag?: SAUPAN005719000
- symbol: SA2058
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2058 [new locus tag: SA_RS11835 ]
- symbol: SA2058
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2322810..2323061
- length: 252
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGAACAATTATTTTAAGTCTATTTATAATTATGAACATCGTTGCAATCATTATGACA
TTGAGTCAACCTCTCACCGTGAATTACTTTAGTTTACGGGTTATACTTATCTTTTTCACA
TTTATATTATCAATCTTTTTCATTTTAATTAAGTCATCCCGATTAAATAATATATTAACG
ATTCTTTCCATTGTGCTTGTCATTATTCATATGGGCATTCTCGCTCATAGCACTTACGTA
TATTTATACTAA60
120
180
240
252
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2058 [new locus tag: SA_RS11835 ]
- symbol: SA2058
- description: hypothetical protein
- length: 83
- theoretical pI: 10.4165
- theoretical MW: 9609.86
- GRAVY: 1.63373
⊟Function[edit | edit source]
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009352
- TAT(Tat/SPI): 0.000164
- LIPO(Sec/SPII): 0.084224
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRTIILSLFIIMNIVAIIMTLSQPLTVNYFSLRVILIFFTFILSIFFILIKSSRLNNILTILSIVLVIIHMGILAHSTYVYLY
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.