NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2034 [new locus tag: SA_RS11695 ]
- pan locus tag?: SAUPAN005688000
- symbol: rpsH
- pan gene symbol?: rpsH
- synonym:
- product: 30S ribosomal protein S8
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2034 [new locus tag: SA_RS11695 ]
- symbol: rpsH
- product: 30S ribosomal protein S8
- replicon: chromosome
- strand: -
- coordinates: 2301568..2301966
- length: 399
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124954 NCBI
- RefSeq: NP_375349 NCBI
- BioCyc: see SA_RS11695
- MicrobesOnline: 104375 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACAATGACAGATCCAATCGCAGATATGCTTACTCGTGTAAGAAACGCAAACATGGTG
CGTCACGAGAAGTTAGAATTACCTGCATCAAATATTAAAAAAGAAATTGCTGAAATCTTA
AAGAGTGAAGGTTTCATTAAAAATGTTGAATACGTAGAAGATGATAAACAAGGTGTACTT
CGTTTATTCTTAAAATATGGTCAAAACGATGAGCGTGTTATCACAGGATTAAAACGTATT
TCAAAACCAGGTTTACGTGTTTATGCAAAAGCTAGCGAAATGCCTAAAGTATTAAATGGT
TTAGGTATTGCATTAGTATCAACTTCTGAAGGTGTAATCACTGACAAAGAAGCAAGAAAA
CGTAATGTTGGTGGAGAAATTATCGCATACGTTTGGTAA60
120
180
240
300
360
399
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2034 [new locus tag: SA_RS11695 ]
- symbol: RpsH
- description: 30S ribosomal protein S8
- length: 132
- theoretical pI: 9.90457
- theoretical MW: 14831.2
- GRAVY: -0.284848
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004597
- TAT(Tat/SPI): 0.000216
- LIPO(Sec/SPII): 0.000697
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTMTDPIADMLTRVRNANMVRHEKLELPASNIKKEIAEILKSEGFIKNVEYVEDDKQGVLRLFLKYGQNDERVITGLKRISKPGLRVYAKASEMPKVLNGLGIALVSTSEGVITDKEARKRNVGGEIIAYVW
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA2027 (adk) adenylate kinase [2] (data from MRSA252) SA0366 (ahpC) alkyl hydroperoxide reductase [2] (data from MRSA252) SA2428 (arcA) arginine deiminase [2] (data from MRSA252) SA2427 (arcB) ornithine carbamoyltransferase [2] (data from MRSA252) SA0831 (cdr) coenzyme A disulfide reductase [2] (data from MRSA252) SA1940 (deoD) purine nucleoside phosphorylase [2] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [2] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [2] (data from MRSA252) SA0545 (eutD) phosphotransacetylase [2] (data from MRSA252) SA0843 (fab) 3-oxoacyl-ACP synthase [2] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [2] (data from MRSA252) SA0915 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [2] (data from MRSA252) SA0505 (fus) elongation factor G [2] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [2] (data from MRSA252) SA1150 (glnA) glutamine-ammonia ligase [2] (data from MRSA252) SA1394 (glyS) glycyl-tRNA synthetase [2] (data from MRSA252) SA0819 (gudB) NAD-specific glutamate dehydrogenase [2] (data from MRSA252) SA1036 (ileS) isoleucyl-tRNA synthetase [2] (data from MRSA252) SA0232 (lctE) L-lactate dehydrogenase [2] (data from MRSA252) SA1704 (map) methionine aminopeptidase [2] (data from MRSA252) SA2334 (mvaS) 3-hydroxy-3-methylglutaryl-CoA synthase [2] (data from MRSA252) SA1109 (nusA) transcription elongation factor NusA [2] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [2] (data from MRSA252) SA0823 (pgi) glucose-6-phosphate isomerase [2] (data from MRSA252) SA0728 (pgk) phosphoglycerate kinase [2] (data from MRSA252) SA0935 (ptsI) phosphoenolpyruvate-protein phosphatase [2] (data from MRSA252) SA1520 (pykA) pyruvate kinase [2] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [2] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [2] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [2] (data from MRSA252) SA0459 (rplY) 50S ribosomal protein L25 [2] (data from MRSA252) SA0500 (rpoB) DNA-directed RNA polymerase subunit beta [2] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [2] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [2] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [2] (data from MRSA252) SA2025 (rpsM) 30S ribosomal protein S13 [2] (data from MRSA252) SA1089 (sucD) succinyl-CoA synthetase subunit alpha [2] (data from MRSA252) SA1499 (tig) trigger factor [2] (data from MRSA252) SA0992 (trxA) thioredoxin [2] (data from MRSA252) SA1100 (tsf) elongation factor Ts [2] (data from MRSA252) SA0437 hypothetical protein [2] (data from MRSA252) SA0618 hypothetical protein [2] (data from MRSA252) SA0627 hypothetical protein [2] (data from MRSA252) SA0759 hypothetical protein [2] (data from MRSA252) SA0859 hypothetical protein [2] (data from MRSA252) SA0873 hypothetical protein [2] (data from MRSA252) SA0941 hypothetical protein [2] (data from MRSA252) SA1360 Xaa-Pro dipeptidase [2] (data from MRSA252) SA1599 translaldolase [2] (data from MRSA252) SA1735 manganese-dependent inorganic pyrophosphatase [2] (data from MRSA252) SA2098 glycerate dehydrogenase [2] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53 2.54 2.55 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)