From AureoWiki
Jump to navigation Jump to search
(Created page with "<protect> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aureodatabase> * <aureodatabase>gene symbol</...")
 
m (Text replacement - "title=SACOL0100" to "title={{PAGENAMEE}}")
Line 43: Line 43:
==Phenotype==
==Phenotype==
</protect>
</protect>
* Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title=SACOL0100&action=edit&section=6 edit]</span>]
* Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title={{PAGENAMEE}}&action=edit&section=6 edit]</span>]


<protect>
<protect>

Revision as of 17:28, 28 October 2014

PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1797 [new locus tag: SA_RS10315 ]
  • symbol: SA1797
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2041163..2041423
  • length: 261
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Gene ID: 1124687 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTATTACAAAACGGGTGACGTATGTCGAAAAATATTTAATGTAGATGGCTTTGATTTT
    CAATTAAGAGTTAAGAAGCGAGCATATAGTGTCGAAATAGTCGTTTTAGATCATGAAGGA
    AATTCAATTGACGGGCTACTAGTTTCTGACGAGAACGATCTATACACAGCTTTAGATATT
    TTGAAACAAAGTATTTATGAATGGATTGAAAATAACACAGATGAACAGGACAGACTAATT
    AACTTAGTCATGAAATGGTAG
    60
    120
    180
    240
    261

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1797 [new locus tag: SA_RS10315 ]
  • symbol: SA1797
  • description: hypothetical protein
  • length: 86
  • theoretical pI: 4.34026
  • theoretical MW: 10164.4
  • GRAVY: -0.345349

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Phage phi 11 orf11 protein homolog
  • PFAM:
    no clan defined DUF1108; Protein of unknown function (DUF1108) (PF06531; HMM-score: 117.1)
    and 1 more
    NFRKB_winged; NFRKB Winged Helix-like (PF14465; HMM-score: 13.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00211
    • TAT(Tat/SPI): 0.000119
    • LIPO(Sec/SPII): 0.000402
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 15927563 NCBI
  • UniProt: A0A0H3JMT7 UniProt
  • protein Genbank : _
  • RefSeq: NP_375096 NCBI

Protein sequence[edit | edit source]

  • MYYKTGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDILKQSIYEWIENNTDEQDRLINLVMKW

Peptides[edit | edit source]

  • experimentally validated:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]