Jump to navigation
Jump to search
m (Text replacement - "gene Genbank" to "gene RefSeq") |
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene GI</aureodatabase> | *<aureodatabase>gene GI</aureodatabase> | ||
* <aureodatabase>gene RefSeq</aureodatabase> | *<aureodatabase>gene RefSeq</aureodatabase> | ||
*<aureodatabase>gene BioCyc</aureodatabase> | |||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 78: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 97: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 106: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 108: | Line 114: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 125: | Line 134: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 131: | Line 140: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 138: | Line 146: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 144: | Line 152: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 03:30, 11 March 2016
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1494 [new locus tag: SA_RS08410 ]
- pan locus tag?: SAUPAN004285000
- symbol: hemC
- pan gene symbol?: hemC
- synonym:
- product: porphobilinogen deaminase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1494 [new locus tag: SA_RS08410 ]
- symbol: hemC
- product: porphobilinogen deaminase
- replicon: chromosome
- strand: -
- coordinates: 1702029..1702955
- length: 927
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124339 NCBI
- RefSeq: NP_374782 NCBI
- BioCyc: see SA_RS08410
- MicrobesOnline: 103808 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901ATGCGTAAATTAGTCGTTGGCTCCAGAAGAAGTAAATTAGCTTTAACACAAAGCCAGCAA
TTTATTAATAAATTAAAAGCTGTCGAGCCAAATCTAGAAATTGAAATTAAAGAAATTGTC
ACGAAAGGCGATCGTATAGTAGATAAACAATTGTCTAAAGTCGGAGGCAAAGGCTTATTT
GTTAAAGAAATACAACATGAACTTTTTGAAAAAAATATCGATATGGCAATACACTCGCTT
AAAGACGTACCAAGTGTAATTCCGGAAGGTTTAACATTAGGTTGTATCCCTGATAGAGAA
TTACCTTTTGATGCGTATATTTCTAAAACACATACACCACTATCCCAATTGCCAGAAGGC
AGTATTATTGGTACTAGTTCATTACGTCGTGGTGCACAAATATTATCTAAGTATCCTAAT
TTAGAGATTAAATGGATTAGAGGTAATATAGATACACGATTAGAAAAGTTACAAACTGAA
GATTATGATGCGATTATTTTAGCTGCAGCTGGTTTAAGAAGAATGGGCTGGTCAGATGAT
ATTGTAACATCTTATCTTGATAGAGATACATTGTTACCTGCAATCGGACAAGGTGCTTTA
GGGATAGAATGTCGTAGTGACGATGAAGAACTATTAACATTATTAAGCAAAGTACATAAT
GATGAGGTTGCAAAATGTGTGACTGCTGAACGAACGTTTTTAGCAGAAATGGATGGTAGT
TGTCAGGTGCCAATCGCAGGATATGCTACAATCTCAGATCAAAAAGAAATCGAATTTACA
GGTTTAATTATGACCCCAGATGGTAAAGAACGATTTGAATATACAATGAACGGAACAGAT
CCGGTTGAGTTAGGCAAAACAGTGAGTAACAAATTAAAAGAGCAAGGTGCTTATGAAATT
ATAAAACGCTTAAATGAACAACATTAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
927
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1494 [new locus tag: SA_RS08410 ]
- symbol: HemC
- description: porphobilinogen deaminase
- length: 308
- theoretical pI: 5.31512
- theoretical MW: 34367.2
- GRAVY: -0.31461
⊟Function[edit | edit source]
- reaction: EC 2.5.1.61? ExPASyHydroxymethylbilane synthase 4 porphobilinogen + H2O = hydroxymethylbilane + 4 NH3
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin hydroxymethylbilane synthase (TIGR00212; EC 2.5.1.61; HMM-score: 352.9)
- TheSEED :
- Porphobilinogen deaminase (EC 2.5.1.61)
- PFAM: PBP (CL0177) Porphobil_deam; Porphobilinogen deaminase, dipyromethane cofactor binding domain (PF01379; HMM-score: 248.3)and 1 moreno clan defined Porphobil_deamC; Porphobilinogen deaminase, C-terminal domain (PF03900; HMM-score: 82)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: dipyrromethane
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005955
- TAT(Tat/SPI): 0.001189
- LIPO(Sec/SPII): 0.000991
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRKLVVGSRRSKLALTQSQQFINKLKAVEPNLEIEIKEIVTKGDRIVDKQLSKVGGKGLFVKEIQHELFEKNIDMAIHSLKDVPSVIPEGLTLGCIPDRELPFDAYISKTHTPLSQLPEGSIIGTSSLRRGAQILSKYPNLEIKWIRGNIDTRLEKLQTEDYDAIILAAAGLRRMGWSDDIVTSYLDRDTLLPAIGQGALGIECRSDDEELLTLLSKVHNDEVAKCVTAERTFLAEMDGSCQVPIAGYATISDQKEIEFTGLIMTPDGKERFEYTMNGTDPVELGKTVSNKLKEQGAYEIIKRLNEQH
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA0033 (aadD) kanamycin nucleotidyltransferase [2] (data from MRSA252) SA1533 (ackA) acetate kinase [2] (data from MRSA252) SA1075 (acpP) acyl carrier protein [2] (data from MRSA252) SA0562 (adh1) alcohol dehydrogenase [2] (data from MRSA252) SA2027 (adk) adenylate kinase [2] (data from MRSA252) SA0366 (ahpC) alkyl hydroperoxide reductase [2] (data from MRSA252) SA0162 (aldA) hypothetical protein [2] (data from MRSA252) SA2428 (arcA) arginine deiminase [2] (data from MRSA252) SA2427 (arcB) ornithine carbamoyltransferase [2] (data from MRSA252) SA0564 (argS) arginyl-tRNA synthetase [2] (data from MRSA252) SA1287 (asnC) asparaginyl-tRNA synthetase [2] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [2] (data from MRSA252) SA0032 (bleO) bleomycin resistance protein [2] (data from MRSA252) SA1184 (citB) aconitate hydratase [2] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [2] (data from MRSA252) SA1518 (citZ) citrate synthase [2] (data from MRSA252) SA1234 (cspA) cold-shock protein CspA [2] (data from MRSA252) SA0471 (cysK) hypothetical protein [2] (data from MRSA252) SA1887 (ddl) D-alanyl-alanine synthetase A [2] (data from MRSA252) SA1940 (deoD) purine nucleoside phosphorylase [2] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [2] (data from MRSA252) SA0002 (dnaN) DNA polymerase III subunit beta [2] (data from MRSA252) SA1941 (dps) general stress protein 20U [2] (data from MRSA252) SA0133 (dra) deoxyribose-phosphate aldolase [2] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [2] (data from MRSA252) SA0545 (eutD) phosphotransacetylase [2] (data from MRSA252) SA0843 (fab) 3-oxoacyl-ACP synthase [2] (data from MRSA252) SA1074 (fabG) 3-oxoacyl-ACP reductase [2] (data from MRSA252) SA0869 (fabI) enoyl-ACP reductase [2] (data from MRSA252) SA1927 (fbaA) fructose-bisphosphate aldolase [2] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [2] (data from MRSA252) SA0915 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [2] (data from MRSA252) SA1102 (frr) ribosome recycling factor [2] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [2] (data from MRSA252) SA0505 (fus) elongation factor G [2] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [2] (data from MRSA252) SA1510 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [2] (data from MRSA252) SA1716 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [2] (data from MRSA252) SA1715 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [2] (data from MRSA252) SA1367 (gcvT) glycine cleavage system aminomethyltransferase T [2] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [2] (data from MRSA252) SA1150 (glnA) glutamine-ammonia ligase [2] (data from MRSA252) SA1342 (gnd) 6-phosphogluconate dehydrogenase [2] (data from MRSA252) SA2204 (gpmA) phosphoglyceromutase [2] (data from MRSA252) SA1681 (gsaB) glutamate-1-semialdehyde aminotransferase [2] (data from MRSA252) SA0376 (guaA) GMP synthase [2] (data from MRSA252) SA0375 (guaB) inositol-monophosphate dehydrogenase [2] (data from MRSA252) SA0819 (gudB) NAD-specific glutamate dehydrogenase [2] (data from MRSA252) SA1305 (hu) DNA-binding protein II [2] (data from MRSA252) SA0512 (ilvE) branched-chain amino acid aminotransferase [2] (data from MRSA252) SA1170 (katA) catalase [2] (data from MRSA252) SA0232 (lctE) L-lactate dehydrogenase [2] (data from MRSA252) SA0475 (lysS) lysyl-tRNA synthetase [2] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [2] (data from MRSA252) SA1926 (murZ) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [2] (data from MRSA252) SA2334 (mvaS) 3-hydroxy-3-methylglutaryl-CoA synthase [2] (data from MRSA252) SA0687 (nrdF) ribonucleotide-diphosphate reductase subunit beta [2] (data from MRSA252) SA1244 (odhB) dihydrolipoamide succinyltransferase [2] (data from MRSA252) SA1609 (pckA) phosphoenolpyruvate carboxykinase [2] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA0945 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 subunit [2] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [2] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [2] (data from MRSA252) SA1521 (pfkA) 6-phosphofructokinase [2] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [2] (data from MRSA252) SA0823 (pgi) glucose-6-phosphate isomerase [2] (data from MRSA252) SA0728 (pgk) phosphoglycerate kinase [2] (data from MRSA252) SA0730 (pgm) phosphoglyceromutase [2] (data from MRSA252) SA0934 (ptsH) phosphocarrier protein HPr [2] (data from MRSA252) SA1520 (pykA) pyruvate kinase [2] (data from MRSA252) SA1044 (pyrC) dihydroorotase [2] (data from MRSA252) SA2341 (rocA) 1-pyrroline-5-carboxylate dehydrogenase [2] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [2] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [2] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [2] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [2] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [2] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [2] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA2017 (rplM) 50S ribosomal protein L13 [2] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [2] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [2] (data from MRSA252) SA2032 (rplR) 50S ribosomal protein L18 [2] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [2] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [2] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [2] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [2] (data from MRSA252) SA2036 (rplX) 50S ribosomal protein L24 [2] (data from MRSA252) SA0459 (rplY) 50S ribosomal protein L25 [2] (data from MRSA252) SA1471 (rpmA) 50S ribosomal protein L27 [2] (data from MRSA252) SA1922 (rpmE2) 50S ribosomal protein L31 [2] (data from MRSA252) SA1503 (rpmI) 50S ribosomal protein L35 [2] (data from MRSA252) SA0500 (rpoB) DNA-directed RNA polymerase subunit beta [2] (data from MRSA252) SA0501 (rpoC) DNA-directed RNA polymerase subunit beta' [2] (data from MRSA252) SA1930 (rpoE) DNA-directed RNA polymerase subunit delta [2] (data from MRSA252) SA1308 (rpsA) 30S ribosomal protein S1 [2] (data from MRSA252) SA1099 (rpsB) 30S ribosomal protein S2 [2] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [2] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [2] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [2] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [2] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [2] (data from MRSA252) SA2034 (rpsH) 30S ribosomal protein S8 [2] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [2] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [2] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [2] (data from MRSA252) SA2025 (rpsM) 30S ribosomal protein S13 [2] (data from MRSA252) SA1116 (rpsO) 30S ribosomal protein S15 [2] (data from MRSA252) SA1081 (rpsP) 30S ribosomal protein S16 [2] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [2] (data from MRSA252) SA2043 (rpsS) 30S ribosomal protein S19 [2] (data from MRSA252) SA1871 (rsbV) anti-sigmaB factor antagonist [2] (data from MRSA252) SA1382 (sodA) superoxide dismutase SodA [2] (data from MRSA252) SA0128 (sodM) superoxide dismutase [2] (data from MRSA252) SA0107 (spa) immunoglobulin G binding protein A [2] (data from MRSA252) SA0456 (spoVG) regulatory protein SpoVG [2] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [2] (data from MRSA252) SA1506 (thrS) threonyl-tRNA synthetase [2] (data from MRSA252) SA1499 (tig) trigger factor [2] (data from MRSA252) SA1177 (tkt) transketolase [2] (data from MRSA252) SA0729 (tpiA) triosephosphate isomerase [2] (data from MRSA252) SA0992 (trxA) thioredoxin [2] (data from MRSA252) SA0719 (trxB) thioredoxine reductase [2] (data from MRSA252) SA1100 (tsf) elongation factor Ts [2] (data from MRSA252) SA0506 (tuf) elongation factor Tu [2] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [2] (data from MRSA252) SA0351 GTP-dependent nucleic acid-binding protein EngD [2] (data from MRSA252) SA0422 hypothetical protein [2] (data from MRSA252) SA0437 hypothetical protein [2] (data from MRSA252) SA0477 pyridoxal biosynthesis lyase PdxS [2] (data from MRSA252) SA0478 glutamine amidotransferase subunit PdxT [2] (data from MRSA252) SA0508 2-amino-3-ketobutyrate CoA ligase [2] (data from MRSA252) SA0528 hypothetical protein [2] (data from MRSA252) SA0537 phosphomethylpyrimidine kinase [2] (data from MRSA252) SA0624 hypothetical protein [2] (data from MRSA252) SA0707 hypothetical protein [2] (data from MRSA252) SA0758 hypothetical protein [2] (data from MRSA252) SA0760 glycine cleavage system protein H [2] (data from MRSA252) SA0774 hypothetical protein [2] (data from MRSA252) SA0775 hypothetical protein [2] (data from MRSA252) SA0802 hypothetical protein [2] (data from MRSA252) SA0829 hypothetical protein [2] (data from MRSA252) SA0859 hypothetical protein [2] (data from MRSA252) SA0873 hypothetical protein [2] (data from MRSA252) SA0941 hypothetical protein [2] (data from MRSA252) SA1019 hypothetical protein [2] (data from MRSA252) SA1224 hypothetical protein [2] (data from MRSA252) SA1255 PTS system glucose-specific transporter subunit enzyme II A [2] (data from MRSA252) SA1256 methionine sulfoxide reductase B [2] (data from MRSA252) SA1359 elongation factor P [2] (data from MRSA252) SA1366 glycine dehydrogenase subunit 1 [2] (data from MRSA252) SA1528 hypothetical protein [2] (data from MRSA252) SA1532 hypothetical protein [2] (data from MRSA252) SA1571 D-alanine aminotransferase [2] (data from MRSA252) SA1572 dipeptidase PepV [2] (data from MRSA252) SA1599 translaldolase [2] (data from MRSA252) SA1709 hypothetical protein [2] (data from MRSA252) SA1735 manganese-dependent inorganic pyrophosphatase [2] (data from MRSA252) SA1924 hypothetical protein [2] (data from MRSA252) SA2395 L-lactate dehydrogenase [2] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [2] (data from MRSA252) SAS044 4-oxalocrotonate tautomerase [2] (data from MRSA252) SAS074 hypothetical protein [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.000 2.001 2.002 2.003 2.004 2.005 2.006 2.007 2.008 2.009 2.010 2.011 2.012 2.013 2.014 2.015 2.016 2.017 2.018 2.019 2.020 2.021 2.022 2.023 2.024 2.025 2.026 2.027 2.028 2.029 2.030 2.031 2.032 2.033 2.034 2.035 2.036 2.037 2.038 2.039 2.040 2.041 2.042 2.043 2.044 2.045 2.046 2.047 2.048 2.049 2.050 2.051 2.052 2.053 2.054 2.055 2.056 2.057 2.058 2.059 2.060 2.061 2.062 2.063 2.064 2.065 2.066 2.067 2.068 2.069 2.070 2.071 2.072 2.073 2.074 2.075 2.076 2.077 2.078 2.079 2.080 2.081 2.082 2.083 2.084 2.085 2.086 2.087 2.088 2.089 2.090 2.091 2.092 2.093 2.094 2.095 2.096 2.097 2.098 2.099 2.100 2.101 2.102 2.103 2.104 2.105 2.106 2.107 2.108 2.109 2.110 2.111 2.112 2.113 2.114 2.115 2.116 2.117 2.118 2.119 2.120 2.121 2.122 2.123 2.124 2.125 2.126 2.127 2.128 2.129 2.130 2.131 2.132 2.133 2.134 2.135 2.136 2.137 2.138 2.139 2.140 2.141 2.142 2.143 2.144 2.145 2.146 2.147 2.148 2.149 2.150 2.151 2.152 2.153 2.154 2.155 2.156 2.157 2.158 2.159 2.160 2.161 2.162 2.163 2.164 2.165 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)