From AureoWiki
Revision as of 10:30, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1364 [new locus tag: SA_RS07720 ]
  • pan locus tag?: SAUPAN004111000
  • symbol: SA1364
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1364 [new locus tag: SA_RS07720 ]
  • symbol: SA1364
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1572118..1572504
  • length: 387
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAGTGCTAGTTTGTACATCGCAATAATTTTAGTTATAGCAATTATTGCTTATATGATT
    GTTCAACAAATTCTTAACAAGCGAGCTGTTAAAGAATTAGATCAAAATGAATTCCATAAT
    GGGATTAGAAAAGCTCAAGTCATCGATGTTAGAGAGAAAGTTGACTATGACTACGGTCAC
    ATTAATGGGTCTCGCAATATTCCTATGACAATGTTCAGGCAACGATTCCAAGGATTAAGA
    AAAGATCAACCGGTATACTTATGTGATGCCAATGGGATTGCTAGCTATAGAGCCGCTCGT
    ATTTTGAAAAAGAATGGATATACAGATATCTATATGTTAAAAGGCGGCTATAAAAAATGG
    ACTGGAAAAATAAAGTCTAAAAAATAG
    60
    120
    180
    240
    300
    360
    387

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1364 [new locus tag: SA_RS07720 ]
  • symbol: SA1364
  • description: hypothetical protein
  • length: 128
  • theoretical pI: 10.4847
  • theoretical MW: 14803.3
  • GRAVY: -0.31875

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 24.1)
    phage shock operon rhodanese PspE (TIGR02981; EC 2.8.1.1; HMM-score: 23.1)
    thiazole biosynthesis domain (TIGR04271; HMM-score: 20.8)
    and 1 more
    PQQ-dependent catabolism-associated CXXCW motif protein (TIGR03865; HMM-score: 14.9)
  • TheSEED  :
    • Rhodanese-like domain protein
    Potassium metabolism Potassium metabolism - no subcategory Glutathione-regulated potassium-efflux system and associated functions  Rhodanese-like domain protein
    and 2 more
    RNA Metabolism RNA processing and modification tRNA modification Archaea  Rhodanese-like domain protein
    Stress Response Oxidative stress Glutaredoxins  Rhodanese-like domain protein
  • PFAM:
    Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 61.9)
    and 3 more
    no clan defined FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 14.6)
    DUF2500; Protein of unknown function (DUF2500) (PF10694; HMM-score: 14.4)
    DUF2749; Protein of unknown function (DUF2749) (PF10907; HMM-score: 11.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.311086
    • TAT(Tat/SPI): 0.001625
    • LIPO(Sec/SPII): 0.009856
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSASLYIAIILVIAIIAYMIVQQILNKRAVKELDQNEFHNGIRKAQVIDVREKVDYDYGHINGSRNIPMTMFRQRFQGLRKDQPVYLCDANGIASYRAARILKKNGYTDIYMLKGGYKKWTGKIKSKK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: CodY (repression) regulon
    CodY(TF)important in Amino acid metabolism; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]