From AureoWiki
Revision as of 09:58, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1038 [new locus tag: SA_RS05905 ]
  • pan locus tag?: SAUPAN003472000
  • symbol: tnp
  • pan gene symbol?:
  • synonym:
  • product: transposase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1038 [new locus tag: SA_RS05905 ]
  • symbol: tnp
  • product: transposase
  • replicon: chromosome
  • strand: -
  • coordinates: 1175212..1175424
  • length: 213
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATTTTGAGTTTCACTCGAATGTCAGTTCGAGGAATAAATAAAGTTAAACGAGAGCTAGGT
    TTTGTATTAATGGCACTTAATATAAGGAAAATAGCAGCTCAACGAGCTGTACATTATAAA
    ATACATATCAAAAAAGCTGATTTCTATCAAATAATTAATAGAAATCAGCTTTTTACATTG
    CCTAAGAACTTAATGTCCCAGCCTCCTTCATAA
    60
    120
    180
    213

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1038 [new locus tag: SA_RS05905 ]
  • symbol: Tnp
  • description: transposase
  • length: 70
  • theoretical pI: 11.9997
  • theoretical MW: 8185.8
  • GRAVY: -0.132857

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Mobile element protein
  • PFAM:
    RNase_H (CL0219) DDE_Tnp_1_6; Transposase DDE domain (PF13751; HMM-score: 16)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.5
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.027553
    • TAT(Tat/SPI): 0.007985
    • LIPO(Sec/SPII): 0.002696
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 15926778 NCBI
  • RefSeq: NP_374311 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MLSFTRMSVRGINKVKRELGFVLMALNIRKIAAQRAVHYKIHIKKADFYQIINRNQLFTLPKNLMSQPPS

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]