NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0830 [new locus tag: SA_RS04715 ]
- pan locus tag?: SAUPAN003080000
- symbol: SA0830
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0830 [new locus tag: SA_RS04715 ]
- symbol: SA0830
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 940904..941293
- length: 390
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123645 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTACATTTACATATATTAAGTTGGGTATTAGCGATTATTTTATTTATCGCTACATAC
TTAAACATTTCAAAAAATCAAGGCGGATCACCATTTTTCAAACCGTTGCACATGATTTTA
CGCTTATTTATGCTGTTGACGTTAATTTCAGGATTTTGGATATTAATTCAGTCATTTATG
AATGGCGGGGCAAATCATATGTTGCTTACATTGAAAATGCTGTGTGGTGTTGCAGTAGTT
GGATTGATGGAAGTGTCGATTGCTAAAAGAAAGAGACATGAACAAAGTCACAAAATGTTT
TGGATAACAATGGCATTAATTATCATCACAATGGTATTAGGTGTCATTCTACCGTTAGGG
CCTATATCAAAATTATTCGGTATTGGCTAA60
120
180
240
300
360
390
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0830 [new locus tag: SA_RS04715 ]
- symbol: SA0830
- description: hypothetical protein
- length: 129
- theoretical pI: 11.181
- theoretical MW: 14484.9
- GRAVY: 1.02171
⊟Function[edit | edit source]
- TIGRFAM: MSEP-CTERM protein (TIGR04286; HMM-score: 14.1)and 2 moreexopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 9.8)oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 6.3)
- TheSEED :
- Uncharacterized protein UPF0344
- PFAM: no clan defined DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 120.9)and 14 moreSirB; Invasion gene expression up-regulator, SirB (PF04247; HMM-score: 20.6)GPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 17.1)no clan defined DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 13.7)DUF3671; Protein of unknown function (PF12420; HMM-score: 12.1)DUF420; Protein of unknown function (DUF420) (PF04238; HMM-score: 8.3)DUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 7.9)DUF4079; Protein of unknown function (DUF4079) (PF13301; HMM-score: 7.6)Ninjurin; Ninjurin (PF04923; HMM-score: 7.2)DUF5090; Domain of unknown function (DUF5090) (PF17009; HMM-score: 6.8)DUF2206; Predicted membrane protein (DUF2206) (PF09971; HMM-score: 6.7)DUF5467; Family of unknown function (DUF5467) (PF17555; HMM-score: 6.6)DUF1345; Protein of unknown function (DUF1345) (PF07077; HMM-score: 6.4)PalH; PalH/RIM21 (PF08733; HMM-score: 6.4)Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 5.6)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008257
- TAT(Tat/SPI): 0.000172
- LIPO(Sec/SPII): 0.035211
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFMNGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLGPISKLFGIG
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.