From AureoWiki
Revision as of 13:10, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0456 [new locus tag: SA_RS02625 ]
  • symbol: spoVG
  • product: regulatory protein SpoVG
  • replicon: chromosome
  • strand: +
  • coordinates: 526400..526702
  • length: 303
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Gene ID: 1123247 NCBI
  • RefSeq: NP_373708 NCBI

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAGTGACAGATGTAAGACTTAGAAAAATACAAACAGATGGACGAATGAAAGCACTC
    GTTTCCATTACATTAGATGAAGCTTTCGTAATTCATGATTTACGTGTAATTGAAGGAAAC
    TCTGGCTTGTTCGTTGCAATGCCAAGTAAACGTACACCAGATGGTGAATTCCGCGACATC
    GCGCATCCTATTAATTCAGATATGAGACAAGAAATTCAAGATGCAGTGATGAAAGTATAT
    GATGAAACAGATGAAGTAGTACCAGATAAAAACGCTACATCAGAAGATTCAGAAGAAGCT
    TAA
    60
    120
    180
    240
    300
    303

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0456 [new locus tag: SA_RS02625 ]
  • symbol: SpoVG
  • description: regulatory protein SpoVG
  • length: 100
  • theoretical pI: 4.40086
  • theoretical MW: 11277.6
  • GRAVY: -0.511

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Protein of unknown function identified by role in sporulation (SpoVG)
    Dormancy and Sporulation Dormancy and Sporulation - no subcategory Sporulation-associated proteins with broader functions  Protein of unknown function identified by role in sporulation (SpoVG)
  • PFAM:
    no clan defined SpoVG; SpoVG (PF04026; HMM-score: 123)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004666
    • TAT(Tat/SPI): 0.000312
    • LIPO(Sec/SPII): 0.000451
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 161376700 NCBI
  • UniProt: Q7A7B5 UniProt
  • protein Genbank : _
  • RefSeq: NP_373708 NCBI

Protein sequence[edit | edit source]

  • MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA

Peptides[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)
Alexandra Resch, Ralf Rosenstein, Christiane Nerz, Friedrich Götz
Differential gene expression profiling of Staphylococcus aureus cultivated under biofilm and planktonic conditions.
Appl Environ Microbiol: 2005, 71(5);2663-76
[PubMed:15870358] [WorldCat.org] [DOI] (P p)