Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0356
- pan locus tag?: SAUPAN001964000
- symbol: SA0356
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0356
- symbol: SA0356
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 414292..414546
- length: 255
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1123136 NCBI
- RefSeq: NP_373603 NCBI
- BioCyc:
- MicrobesOnline: 102629 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATTAATATAGGGTACATATTCACAAATGCAGCTGGTGGCCCTATCGACTCGAACAAAATT
AGCAACATTATTAAAGGGGGCACTATCAAAGAGACAACTGAGATTAGTTCTATTAAGAAA
CCTGTAACGACGCATACATTACATCATTCGCATATATCTACACTTGCTCAATTAGGAATT
AACTTAAAAGCAATGCAAGAGCATGTAGGTCATTCAGATTATAAAAAATCTAGAGATATA
CACACATGTTACTAA60
120
180
240
255
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0356
- symbol: SA0356
- description: hypothetical protein
- length: 84
- theoretical pI: 9.58982
- theoretical MW: 9214.44
- GRAVY: -0.384524
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair integron integrase (TIGR02249; HMM-score: 37.6)Mobile and extrachromosomal element functions Other integron integrase (TIGR02249; HMM-score: 37.6)DNA metabolism DNA replication, recombination, and repair tyrosine recombinase XerD (TIGR02225; HMM-score: 34.4)DNA metabolism DNA replication, recombination, and repair tyrosine recombinase XerC (TIGR02224; HMM-score: 30.5)
- TheSEED:
- PFAM: DNA-mend (CL0382) Phage_integrase; Phage integrase family (PF00589; HMM-score: 35)and 1 moreHTH (CL0123) HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.018009
- TAT(Tat/SPI): 0.000518
- LIPO(Sec/SPII): 0.003711
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNIGYIFTNAAGGPIDSNKISNIIKGGTIKETTEISSIKKPVTTHTLHHSHISTLAQLGINLKAMQEHVGHSDYKKSRDIHTCY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.