From AureoWiki
Revision as of 21:19, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0081 [new locus tag: SA_RS00560 ]
  • pan locus tag?: SAUPAN000488000
  • symbol: SA0081
  • pan gene symbol?: cstR
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0081 [new locus tag: SA_RS00560 ]
  • symbol: SA0081
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 91124..91384
  • length: 261
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAATTATGATAAAAAAATGATTAATCGTATTAATAGAATACAAGGGCAACTAAATGGA
    ATTATTAAAATGATGGAGGAAGGAAAAGACTGTAAAGATGTCATTACACAAATAAGTGCA
    TCAAAGAGTTCACTCCAACGCTTGATGGGTATCATTATTAGTGAGAATTTAATAGAATGT
    GTAAAAGTAGCTGCGGATGATGAAGAAAGCTCCCAAGAGTTAATTAATGAAGCTGTAAAC
    TTATTGGTGAAAAGTAAGTAA
    60
    120
    180
    240
    261

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0081 [new locus tag: SA_RS00560 ]
  • symbol: SA0081
  • description: hypothetical protein
  • length: 86
  • theoretical pI: 5.12449
  • theoretical MW: 9669.22
  • GRAVY: -0.265116

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Uncharacterized protein YrkD
  • PFAM:
    no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 87)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003775
    • TAT(Tat/SPI): 0.000594
    • LIPO(Sec/SPII): 0.000425
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSLQRLMGIIISENLIECVKVAADDEESSQELINEAVNLLVKSK

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Justin L Luebke, Jiangchuan Shen, Kevin E Bruce, Thomas E Kehl-Fie, Hui Peng, Eric P Skaar, David P Giedroc
The CsoR-like sulfurtransferase repressor (CstR) is a persulfide sensor in Staphylococcus aureus.
Mol Microbiol: 2014, 94(6);1343-60
[PubMed:25318663] [WorldCat.org] [DOI] (I p)
Jiangchuan Shen, Mary E Keithly, Richard N Armstrong, Khadine A Higgins, Katherine A Edmonds, David P Giedroc
Staphylococcus aureus CstB Is a Novel Multidomain Persulfide Dioxygenase-Sulfurtransferase Involved in Hydrogen Sulfide Detoxification.
Biochemistry: 2015, 54(29);4542-54
[PubMed:26177047] [WorldCat.org] [DOI] (I p)