NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS10795 [old locus tag: NWMN_1876 ]
- pan locus tag?: SAUPAN005018000
- symbol: NWMN_RS10795
- pan gene symbol?: scn
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS10795 [old locus tag: NWMN_1876 ]
- symbol: NWMN_RS10795
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2089433..2089783
- length: 351
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: WP_000702263 NCBI
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAATTAGAAAATCTATACTTGCGGGAACTTTAGCAATCGTTTTAGCATCACCACTA
GTAACTAATCTAGATAAAAATGAGGCACAAGCTAGCACAAGCTTGCCAACATCGAATGAA
TATCAAAACGAAAAGTTAGCTAATGAATTAAAATCGTTATTAGATGAACTAAATGTTAAT
GAATTAGCTACTGGAAGTTTAAACACTTATTATAAGCGAACTATAAAAATTTCAGGTCAA
AAAGCAATGTATGCTCTTAAGTCAAAAGACTTTAAGAAAATGTCAGAAGCAAAATATCAA
CTTCAAAAGATTTATAACGAAATTGACGAAGCACTAAAAAGTAAATATTAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS10795 [old locus tag: NWMN_1876 ]
- symbol: NWMN_RS10795
- description: hypothetical protein
- length: 116
- theoretical pI: 9.83807
- theoretical MW: 13067
- GRAVY: -0.516379
⊟Function[edit | edit source]
- TIGRFAM: integral membrane protein (TIGR04561; HMM-score: 12.8)
- TheSEED: data available for N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined CompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 162.7)and 6 moreEcoR124_C; Type I restriction and modification enzyme - subunit R C terminal (PF12008; HMM-score: 18.4)IDEAL; IDEAL domain (PF08858; HMM-score: 17.4)FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 14.6)Minor_capsid_3; Minor capsid protein from bacteriophage (PF12691; HMM-score: 13.1)HUP (CL0039) Diphthami_syn_2; Diphthamide synthase (PF01902; HMM-score: 12.9)SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 12.4)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helices: 0
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 31 aa
- SP(Sec/SPI): 0.966405
- TAT(Tat/SPI): 0.009268
- LIPO(Sec/SPII): 0.009014
- Cleavage Site: CS pos: 31-32. AQA-ST. Pr: 0.8237
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
⊟Peptides[edit | edit source]
- experimentally validated: data available for NCTC8325
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator: SaeR see NWMN_1876
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.