COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS08140
- pan locus tag?:
- symbol: NWMN_RS08140
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS08140
- symbol: NWMN_RS08140
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1613380..1613526
- length: 147
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121TTGATGCTAACAGCAATTTATTTTTCCATTTTCACTTTTTATATCAGTCAATATAGTTTA
AAATTAAAGACATTATATAATATTGAAACTGACTATAACTATAAGATTGTTTTGTTATTG
AAAGAAGGGAAAACGCATGAATCATGA60
120
147
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS08140
- symbol: NWMN_RS08140
- description: hypothetical protein
- length: 48
- theoretical pI: 8.84228
- theoretical MW: 5776.74
- GRAVY: 0.108333
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: Peptidase_MA (CL0126) Peptidase_M6; Immune inhibitor A peptidase M6 (PF05547; HMM-score: 11.5)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.057238
- TAT(Tat/SPI): 0.001184
- LIPO(Sec/SPII): 0.02665
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- UniProt:
- RefSeq: WP_001789879 NCBI
⊟Protein sequence[edit | edit source]
- MMLTAIYFSIFTFYISQYSLKLKTLYNIETDYNYKIVLLLKEGKTHES
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.