Jump to navigation
Jump to search
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene | *<aureodatabase>gene location</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene BioCyc</aureodatabase> | ||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 77: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 96: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 105: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 107: | Line 113: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 124: | Line 133: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 130: | Line 139: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 137: | Line 145: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 143: | Line 151: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 01:41, 11 March 2016
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS08090 [old locus tag: NWMN_1433 ]
- pan locus tag?: SAUPAN004106000
- symbol: NWMN_RS08090
- pan gene symbol?: efp
- synonym:
- product: elongation factor P
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS08090 [old locus tag: NWMN_1433 ]
- symbol: NWMN_RS08090
- product: elongation factor P
- replicon: chromosome
- strand: -
- coordinates: 1604420..1604977
- length: 558
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGATTTCGGTTAATGATTTTAAAACAGGTTTAACAATTTCTGTTGATAACGCTATTTGG
AAAGTTATAGACTTCCAACATGTAAAGCCTGGTAAAGGTTCAGCATTCGTTCGTTCAAAA
TTACGTAATTTAAGAACTGGTGCAATTCAAGAGAAAACGTTTAGAGCTGGTGAAAAAGTT
GAACCAGCAATGATTGAAAATCGTCGCATGCAATATTTATATGCTGACGGAGATAATCAT
GTATTTATGGATAATGAAAGCTTTGAACAAACAGAACTTTCAAGTGATTACTTAAAAGAA
GAATTGAATTACTTAAAAGAAGGTATGGAAGTACAAATTCAAACATACGAAGGTGAAACT
ATCGGTGTTGAATTACCTAAAACTGTTGAATTAACAGTAACTGAAACAGAACCTGGTATT
AAAGGTGATACTGCAACTGGTGCCACTAAATCGGCAACTGTTGAAACTGGTTATACATTA
AATGTACCTTTATTTGTAAACGAAGGTGACGTTTTAATTATCAACACTGGTGATGGAAGC
TACATTTCAAGAGGATAA60
120
180
240
300
360
420
480
540
558
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS08090 [old locus tag: NWMN_1433 ]
- symbol: NWMN_RS08090
- description: elongation factor P
- length: 185
- theoretical pI: 4.46265
- theoretical MW: 20553.9
- GRAVY: -0.41027
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Translation factors translation elongation factor P (TIGR00038; HMM-score: 265.8)and 2 moreProtein synthesis Translation factors elongation factor P-like protein YeiP (TIGR02178; HMM-score: 127.2)Protein synthesis Translation factors translation elongation factor IF5A (TIGR00037; HMM-score: 22.7)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: KOW (CL0107) EFP_N; Elongation factor P (EF-P) KOW-like domain (PF08207; HMM-score: 96.5)OB (CL0021) Elong-fact-P_C; Elongation factor P, C-terminal (PF09285; HMM-score: 90.7)EFP; Elongation factor P (EF-P) OB domain (PF01132; HMM-score: 82.6)and 1 moreno clan defined SMC_Nse1; Nse1 non-SMC component of SMC5-6 complex (PF07574; HMM-score: 15)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002655
- TAT(Tat/SPI): 0.000227
- LIPO(Sec/SPII): 0.00036
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRMQYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTLNVPLFVNEGDVLIINTGDGSYISRG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
NWMN_RS07690 (asnC) asparagine--tRNA ligase [1] (data from MRSA252) NWMN_RS11780 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) NWMN_RS10565 (gatA) glutamyl-tRNA(Gln) amidotransferase subunit A [1] (data from MRSA252) NWMN_RS06630 (nusA) transcription termination/antitermination protein NusA [1] (data from MRSA252) NWMN_RS00010 DNA polymerase III subunit beta [1] (data from MRSA252) NWMN_RS00045 serine--tRNA ligase [1] (data from MRSA252) NWMN_RS00075 50S ribosomal protein L9 [1] (data from MRSA252) NWMN_RS00315 peptidoglycan-binding protein LysM [1] (data from MRSA252) NWMN_RS00885 formate acetyltransferase [1] (data from MRSA252) NWMN_RS00980 L-lactate dehydrogenase [1] (data from MRSA252) NWMN_RS01060 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) NWMN_RS01965 acetyl-CoA acyltransferase [1] (data from MRSA252) NWMN_RS02010 GTP-binding protein YchF [1] (data from MRSA252) NWMN_RS02020 30S ribosomal protein S6 [1] (data from MRSA252) NWMN_RS02135 hypothetical protein [1] (data from MRSA252) NWMN_RS02150 IMP dehydrogenase [1] (data from MRSA252) NWMN_RS02505 YbaB/EbfC family nucleoid-associated protein [1] (data from MRSA252) NWMN_RS02620 pur operon repressor [1] (data from MRSA252) NWMN_RS02630 stage V sporulation protein G [1] (data from MRSA252) NWMN_RS02655 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) NWMN_RS02690 RNA-binding protein S1 [1] (data from MRSA252) NWMN_RS02710 redox-regulated molecular chaperone Hsp33 [1] (data from MRSA252) NWMN_RS02715 cysteine synthase [1] (data from MRSA252) NWMN_RS02815 pyridoxal 5'-phosphate synthase lyase subunit PdxS [1] (data from MRSA252) NWMN_RS02865 glutamate--tRNA ligase [1] (data from MRSA252) NWMN_RS02905 transcription termination/antitermination protein NusG [1] (data from MRSA252) NWMN_RS02910 50S ribosomal protein L11 [1] (data from MRSA252) NWMN_RS02915 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_RS02920 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_RS02925 50S ribosomal protein L7/L12 [1] (data from MRSA252) NWMN_RS02935 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) NWMN_RS02940 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) NWMN_RS02950 30S ribosomal protein S12 [1] (data from MRSA252) NWMN_RS02955 30S ribosomal protein S7 [1] (data from MRSA252) NWMN_RS02960 elongation factor G [1] (data from MRSA252) NWMN_RS02965 elongation factor Tu [1] (data from MRSA252) NWMN_RS02975 2-amino-3-ketobutyrate CoA ligase [1] (data from MRSA252) NWMN_RS02995 branched chain amino acid aminotransferase [1] (data from MRSA252) NWMN_RS03075 3-hexulose-6-phosphate synthase [1] (data from MRSA252) NWMN_RS03160 phosphate acetyltransferase [1] (data from MRSA252) NWMN_RS03300 zinc-dependent alcohol dehydrogenase [1] (data from MRSA252) NWMN_RS03315 arginine--tRNA ligase [1] (data from MRSA252) NWMN_RS03520 dihydroxyacetone kinase subunit DhaK [1] (data from MRSA252) NWMN_RS03590 hypothetical protein [1] (data from MRSA252) NWMN_RS03620 transcriptional regulator [1] (data from MRSA252) NWMN_RS03715 MarR family transcriptional regulator [1] (data from MRSA252) NWMN_RS03830 hypothetical protein [1] (data from MRSA252) NWMN_RS04075 ribosomal subunit interface protein [1] (data from MRSA252) NWMN_RS04175 ATP-dependent Clp protease proteolytic subunit [1] (data from MRSA252) NWMN_RS04195 aldehyde dehydrogenase [1] (data from MRSA252) NWMN_RS04200 phosphoglycerate kinase [1] (data from MRSA252) NWMN_RS04205 triose-phosphate isomerase [1] (data from MRSA252) NWMN_RS04210 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [1] (data from MRSA252) NWMN_RS04215 enolase [1] (data from MRSA252) NWMN_RS04305 cold-shock protein [1] (data from MRSA252) NWMN_RS04385 glycine cleavage system protein H [1] (data from MRSA252) NWMN_RS04445 Fe-S cluster assembly protein SufD [1] (data from MRSA252) NWMN_RS04460 Fe-S cluster assembly protein SufB [1] (data from MRSA252) NWMN_RS04545 D-alanine--poly(phosphoribitol) ligase [1] (data from MRSA252) NWMN_RS04590 NADH dehydrogenase [1] (data from MRSA252) NWMN_RS04675 NAD-specific glutamate dehydrogenase [1] (data from MRSA252) NWMN_RS04700 glucose-6-phosphate isomerase [1] (data from MRSA252) NWMN_RS04740 CoA-disulfide reductase [1] (data from MRSA252) NWMN_RS04805 beta-ketoacyl-[acyl-carrier-protein] synthase II [1] (data from MRSA252) NWMN_RS04885 oligoendopeptidase F [1] (data from MRSA252) NWMN_RS04935 enoyl-ACP reductase [1] (data from MRSA252) NWMN_RS04955 hypothetical protein [1] (data from MRSA252) NWMN_RS05220 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [1] (data from MRSA252) NWMN_RS05320 phosphocarrier protein HPr [1] (data from MRSA252) NWMN_RS05325 phosphoenolpyruvate--protein phosphotransferase [1] (data from MRSA252) NWMN_RS05380 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) NWMN_RS05390 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) NWMN_RS05460 translational GTPase TypA [1] (data from MRSA252) NWMN_RS05970 thiol reductase thioredoxin [1] (data from MRSA252) NWMN_RS06210 cell division protein FtsZ [1] (data from MRSA252) NWMN_RS06245 isoleucine--tRNA ligase [1] (data from MRSA252) NWMN_RS06435 beta-ketoacyl-ACP reductase [1] (data from MRSA252) NWMN_RS06475 30S ribosomal protein S16 [1] (data from MRSA252) NWMN_RS06490 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_RS06520 succinyl-CoA ligase subunit alpha [1] (data from MRSA252) NWMN_RS06565 GTP-sensing pleiotropic transcriptional regulator CodY [1] (data from MRSA252) NWMN_RS06575 30S ribosomal protein S2 [1] (data from MRSA252) NWMN_RS06585 elongation factor Ts [1] (data from MRSA252) NWMN_RS06595 ribosome-recycling factor [1] (data from MRSA252) NWMN_RS06645 translation initiation factor IF-2 [1] (data from MRSA252) NWMN_RS06665 30S ribosomal protein S15 [1] (data from MRSA252) NWMN_RS06670 polyribonucleotide nucleotidyltransferase [1] (data from MRSA252) NWMN_RS06840 glutamine synthetase [1] (data from MRSA252) NWMN_RS07035 catalase [1] (data from MRSA252) NWMN_RS07080 transketolase [1] (data from MRSA252) NWMN_RS07120 aconitate hydratase [1] (data from MRSA252) NWMN_RS07340 ABC transporter ATP-binding protein [1] (data from MRSA252) NWMN_RS07460 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) NWMN_RS07495 N-acetyltransferase [1] (data from MRSA252) NWMN_RS07610 alanine dehydrogenase [1] (data from MRSA252) NWMN_RS07785 DNA-binding protein HU [1] (data from MRSA252) NWMN_RS07800 30S ribosomal protein S1 [1] (data from MRSA252) NWMN_RS08000 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) [1] (data from MRSA252) NWMN_RS08095 peptidase M24 family protein [1] (data from MRSA252) NWMN_RS08125 glycine dehydrogenase [1] (data from MRSA252) NWMN_RS08215 superoxide dismutase [1] (data from MRSA252) NWMN_RS08350 molecular chaperone DnaK [1] (data from MRSA252) NWMN_RS08380 30S ribosomal protein S20 [1] (data from MRSA252) NWMN_RS08675 50S ribosomal protein L27 [1] (data from MRSA252) NWMN_RS08685 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_RS08795 trigger factor [1] (data from MRSA252) NWMN_RS08840 threonine--tRNA ligase [1] (data from MRSA252) NWMN_RS08865 aldehyde dehydrogenase [1] (data from MRSA252) NWMN_RS08905 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) NWMN_RS08930 pyruvate kinase [1] (data from MRSA252) NWMN_RS08935 ATP-dependent 6-phosphofructokinase [1] (data from MRSA252) NWMN_RS08950 NAD-dependent malic enzyme 4 [1] (data from MRSA252) NWMN_RS08970 universal stress protein [1] (data from MRSA252) NWMN_RS08980 dipeptidase [1] (data from MRSA252) NWMN_RS08995 universal stress protein UspA [1] (data from MRSA252) NWMN_RS09000 acetate kinase [1] (data from MRSA252) NWMN_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) NWMN_RS09125 formate--tetrahydrofolate ligase [1] (data from MRSA252) NWMN_RS09225 D-alanine aminotransferase [1] (data from MRSA252) NWMN_RS09230 dipeptidase PepV [1] (data from MRSA252) NWMN_RS09265 leucine--tRNA ligase [1] (data from MRSA252) NWMN_RS09385 transaldolase [1] (data from MRSA252) NWMN_RS09425 S-adenosylmethionine synthase [1] (data from MRSA252) NWMN_RS09430 phosphoenolpyruvate carboxykinase (ATP) [1] (data from MRSA252) NWMN_RS09735 signal transduction protein TRAP [1] (data from MRSA252) NWMN_RS09840 glucosamine-6-phosphate isomerase [1] (data from MRSA252) NWMN_RS10105 glutamine amidotransferase [1] (data from MRSA252) NWMN_RS10485 methionine aminopeptidase [1] (data from MRSA252) NWMN_RS10520 non-heme ferritin [1] (data from MRSA252) NWMN_RS10670 manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) NWMN_RS11175 molecular chaperone GroEL [1] (data from MRSA252) NWMN_RS11180 co-chaperone GroES [1] (data from MRSA252) NWMN_RS11495 D-alanine--D-alanine ligase [1] (data from MRSA252) NWMN_RS11590 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) NWMN_RS11655 uracil phosphoribosyltransferase [1] (data from MRSA252) NWMN_RS11695 50S ribosomal protein L31 type B [1] (data from MRSA252) NWMN_RS11715 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) NWMN_RS11720 fructose-bisphosphate aldolase [1] (data from MRSA252) NWMN_RS11730 CTP synthetase [1] (data from MRSA252) NWMN_RS11735 DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) NWMN_RS11795 purine-nucleoside phosphorylase [1] (data from MRSA252) NWMN_RS11875 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) NWMN_RS12015 hypothetical protein [1] (data from MRSA252) NWMN_RS12080 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) NWMN_RS12260 30S ribosomal protein S9 [1] (data from MRSA252) NWMN_RS12265 50S ribosomal protein L13 [1] (data from MRSA252) NWMN_RS12290 50S ribosomal protein L17 [1] (data from MRSA252) NWMN_RS12295 DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) NWMN_RS12300 30S ribosomal protein S11 [1] (data from MRSA252) NWMN_RS12305 30S ribosomal protein S13 [1] (data from MRSA252) NWMN_RS12320 adenylate kinase [1] (data from MRSA252) NWMN_RS12340 30S ribosomal protein S5 [1] (data from MRSA252) NWMN_RS12350 50S ribosomal protein L6 [1] (data from MRSA252) NWMN_RS12355 30S ribosomal protein S8 [1] (data from MRSA252) NWMN_RS12365 50S ribosomal protein L5 [1] (data from MRSA252) NWMN_RS12370 50S ribosomal protein L24 [1] (data from MRSA252) NWMN_RS12380 30S ribosomal protein S17 [1] (data from MRSA252) NWMN_RS12390 50S ribosomal protein L16 [1] (data from MRSA252) NWMN_RS12395 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_RS12400 50S ribosomal protein L22 [1] (data from MRSA252) NWMN_RS12410 50S ribosomal protein L2 [1] (data from MRSA252) NWMN_RS12415 50S ribosomal protein L23 [1] (data from MRSA252) NWMN_RS12420 50S ribosomal protein L4 [1] (data from MRSA252) NWMN_RS12430 30S ribosomal protein S10 [1] (data from MRSA252) NWMN_RS12725 2-hydroxyacid dehydrogenase [1] (data from MRSA252) NWMN_RS13320 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [1] (data from MRSA252) NWMN_RS13880 fructose 1,6-bisphosphatase [1] (data from MRSA252) NWMN_RS13925 lactate dehydrogenase [1] (data from MRSA252) NWMN_RS14060 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252) NWMN_RS14105 L-glutamate gamma-semialdehyde dehydrogenase [1] (data from MRSA252) NWMN_RS14325 3-methyl-2-oxobutanoate hydroxymethyltransferase [1] (data from MRSA252) NWMN_RS14340 L-lactate dehydrogenase [1] (data from MRSA252) NWMN_RS14365 class I fructose-bisphosphate aldolase [1] (data from MRSA252) NWMN_RS14370 malate:quinone oxidoreductase [1] (data from MRSA252) NWMN_RS14555 ornithine carbamoyltransferase [1] (data from MRSA252) NWMN_RS14560 arginine deiminase [1] (data from MRSA252) NWMN_RS14600 mannose-6-phosphate isomerase, class I [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 1.136 1.137 1.138 1.139 1.140 1.141 1.142 1.143 1.144 1.145 1.146 1.147 1.148 1.149 1.150 1.151 1.152 1.153 1.154 1.155 1.156 1.157 1.158 1.159 1.160 1.161 1.162 1.163 1.164 1.165 1.166 1.167 1.168 1.169 1.170 1.171 1.172 1.173 1.174 1.175 1.176 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)