NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS06755 [old locus tag: NWMN_1200 ]
- pan locus tag?: SAUPAN003595000
- symbol: NWMN_RS06755
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS06755 [old locus tag: NWMN_1200 ]
- symbol: NWMN_RS06755
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1323479..1323772
- length: 294
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAGACACATTAATGAGTATACAAATAATTCCTAAAACACCAAACAATGACAATGTT
ATACCTTACGTAGACGAGGCGATTAAAATAATTGACGAATCTGGTTTGCATTTTAGAGTA
GGTCCGTTAGAAACGACAGTACAAGGAAATATGAATGAATGTTTAATTTTAATACAATCA
TTAAATGAACGAATGGTGGAACTTGAATGTCCAAGTATTATTAGCCAAGTTAAGTTTTAT
CATGTGCCAGATGGCATCACTATTGAAACTTTAACTGAAAAATATGATGAATAA60
120
180
240
294
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS06755 [old locus tag: NWMN_1200 ]
- symbol: NWMN_RS06755
- description: hypothetical protein
- length: 97
- theoretical pI: 4.15885
- theoretical MW: 11034.6
- GRAVY: -0.119588
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General uncharacterized protein, MTH1187 family (TIGR00106; HMM-score: 31.3)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: MTH1187-YkoF (CL0360) Thiamine_BP; Thiamine-binding protein (PF01910; HMM-score: 59.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004718
- TAT(Tat/SPI): 0.000076
- LIPO(Sec/SPII): 0.000233
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQSLNERMVELECPSIISQVKFYHVPDGITIETLTEKYDE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.