Jump to navigation
Jump to search
(Created page with "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aur...") |
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
||
Line 101: | Line 101: | ||
* <aureodatabase>protein GI</aureodatabase> | * <aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein UniProt</aureodatabase> | * <aureodatabase>protein UniProt</aureodatabase> | ||
* <aureodatabase>protein RefSeq</aureodatabase> | * <aureodatabase>protein RefSeq</aureodatabase> | ||
</protect> | </protect> |
Revision as of 16:16, 10 March 2016
NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS05685 [old locus tag: NWMN_1008 ]
- pan locus tag?: SAUPAN001390000
- symbol: NWMN_RS05685
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS05685 [old locus tag: NWMN_1008 ]
- symbol: NWMN_RS05685
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1111781..1112029
- length: 249
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACCATGACAGATAACGCGCGTAAAGAATACTTAAACCAATTTTTCGGCTCTAAGAGA
TATCTGTATCAGGATAACGAGCGAGTGGCACATATCCATGTAGTGAATGGCGCTTATTAC
TTTCACGGGCATATCGTACCAGATTGGCAAGGTGTGAAAAAGACATTTGATACAGCGGAA
GAGCTCGGAATATATATAAAGCAACATGGTTTGGAATACGAGGAACAGAAGCAACTAACT
TTATTTTAG60
120
180
240
249
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS05685 [old locus tag: NWMN_1008 ]
- symbol: NWMN_RS05685
- description: hypothetical protein
- length: 82
- theoretical pI: 6.67996
- theoretical MW: 9800.93
- GRAVY: -0.706098
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for NCTC8325
- PFAM: no clan defined Phage_Orf51; Phage Conserved Open Reading Frame 51 (PF06194; HMM-score: 181.2)and 1 morePeptidase_CA (CL0125) Guanylate_cyc_2; Guanylylate cyclase (PF09778; HMM-score: 12)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005272
- TAT(Tat/SPI): 0.000211
- LIPO(Sec/SPII): 0.000393
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTMTDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGAYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF
⊟Peptides[edit | edit source]
- experimentally validated: data available for NCTC8325
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.