NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS04555 [old locus tag: NWMN_0805 ]
- pan locus tag?: SAUPAN003033000
- symbol: NWMN_RS04555
- pan gene symbol?: dltC
- synonym:
- product: D-alanine--poly(phosphoribitol) ligase subunit 2
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS04555 [old locus tag: NWMN_0805 ]
- symbol: NWMN_RS04555
- product: D-alanine--poly(phosphoribitol) ligase subunit 2
- replicon: chromosome
- strand: +
- coordinates: 893751..893987
- length: 237
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGAATTTAGAGAACAAGTATTAAATTTATTAGCAGAAGTAGCAGAAAATGATATTGTA
AAAGAAAATCCAGACGTAGAAATTTTTGAAGAAGGTATTATTGATTCTTTCCAAACAGTT
GGATTATTATTAGAGATTCAAAATAAACTTGATATCGAAGTATCTATTATGGACTTTGAT
AGAGATGAGTGGGCAACACCAAATAAAATCGTTGAAGCATTAGAAGAGTTACGATGA60
120
180
237
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS04555 [old locus tag: NWMN_0805 ]
- symbol: NWMN_RS04555
- description: D-alanine--poly(phosphoribitol) ligase subunit 2
- length: 78
- theoretical pI: 3.67678
- theoretical MW: 9063.14
- GRAVY: -0.164103
⊟Function[edit | edit source]
- reaction: EC 6.1.1.13? ExPASyD-alanine--poly(phosphoribitol) ligase ATP + D-alanine + poly(ribitol phosphate) = AMP + diphosphate + O-D-alanyl-poly(ribitol phosphate)
- TIGRFAM: Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan D-alanine--poly(phosphoribitol) ligase, subunit 2 (TIGR01688; EC 6.1.1.13; HMM-score: 136.3)and 1 moreFatty acid and phospholipid metabolism Biosynthesis acyl carrier protein (TIGR00517; HMM-score: 13.5)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: PP-binding (CL0314) PP-binding; Phosphopantetheine attachment site (PF00550; HMM-score: 34.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002447
- TAT(Tat/SPI): 0.000177
- LIPO(Sec/SPII): 0.000198
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFDRDEWATPNKIVEALEELR
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.