From AureoWiki
Revision as of 01:31, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS04325 [old locus tag: NWMN_0765 ]
  • pan locus tag?: SAUPAN002806000
  • symbol: NWMN_RS04325
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS04325 [old locus tag: NWMN_0765 ]
  • symbol: NWMN_RS04325
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 859972..860160
  • length: 189
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (859972..860160) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0765

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACG
    TTTATACTCGTATTAATGAAAAAAACTAGCAAAGAATCTAAAAAAGAGTCCTATTTAAGT
    TTCACTATCATTCTCTATATTTTTGGATTCGCTATATTAATATACACATTTATATTTGGT
    GTGCTATAA
    60
    120
    180
    189

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS04325 [old locus tag: NWMN_0765 ]
  • symbol: NWMN_RS04325
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.0084
  • theoretical MW: 7186.81
  • GRAVY: 1.46452

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for N315, NCTC8325
  • PFAM:
    no clan defined BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 15.4)
    GPCR_A (CL0192) Bac_rhodopsin; Bacteriorhodopsin-like protein (PF01036; HMM-score: 15.1)
    no clan defined DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 14)
    Intg_mem_TP0381; Integral membrane protein (intg_mem_TP0381) (PF09529; HMM-score: 13.8)
    DUF3742; Protein of unknown function (DUF3742) (PF12553; HMM-score: 12.4)
    and 15 more
    PGG; Domain of unknown function (PF13962; HMM-score: 12.2)
    SLC3A2_N; Solute carrier family 3 member 2 N-terminus (PF16028; HMM-score: 11.8)
    SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 11.7)
    MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 11.5)
    DUF3671; Protein of unknown function (PF12420; HMM-score: 11)
    TEX29; Testis-expressed sequence 29 protein (PF15839; HMM-score: 10.8)
    Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 10.7)
    no clan defined DUF4051; Protein of unknown function (DUF4051) (PF13260; HMM-score: 10.2)
    CcmH; Cytochrome C biogenesis protein (PF03918; HMM-score: 9.9)
    NfeD-like (CL0252) NfeD; NfeD-like C-terminal, partner-binding (PF01957; HMM-score: 9.6)
    no clan defined DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 8.9)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 8.9)
    Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 8.2)
    no clan defined Tmemb_55A; Transmembrane protein 55A (PF09788; HMM-score: 6)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 4.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009117
    • TAT(Tat/SPI): 0.000759
    • LIPO(Sec/SPII): 0.123124
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTIILYIFGFAILIYTFIFGVL

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]