NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS00485 [old locus tag: NWMN_0086 ]
- pan locus tag?: SAUPAN000956000
- symbol: NWMN_RS00485
- pan gene symbol?: phnC
- synonym:
- product: phosphonates import ATP-binding protein PhnC
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS00485 [old locus tag: NWMN_0086 ]
- symbol: NWMN_RS00485
- product: phosphonates import ATP-binding protein PhnC
- replicon: chromosome
- strand: -
- coordinates: 108098..108871
- length: 774
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGAGTCAAATCGAATTTAAAAACGTCAGTAAAGTCTATCCTAACGGTCATGTAGGCTTG
AAAAATATTAACTTAAATATTGAAAAAGGTGAATTTGCAGTTATTGTCGGACTATCTGGT
GCTGGGAAATCCACGTTATTAAGATCTGTAAATCGTTTGCATGATATCACGTCAGGTGAA
ATTTTCATCCAAGGTAAATCAATCACTAAAGCCCATGGTAAAGCATTATTAGAAATGCGC
CGAAATATAGGTATGATTTTCCAACATTTTAATTTAGTTAAACGGTCAAGTGTATTACGA
AATGTACTAAGTGGACGTGTAGGTTATCACCCTACTTGGAAAATGGTATTAGGTTTATTC
CCAAAAGAAGACAAAATTAAGGCAATGGATGCACTAGAACGCGTCAATATCTTAGATAAA
TATAATCAACGCTCTGATGAATTATCAGGTGGCCAACAACAACGTATATCTATTGCACGT
GCGCTATGCCAAGAATCTGAAATTATTCTTGCAGATGAACCAGTTGCTTCATTAGACCCA
TTAACTACGAAACAGGTTATGGATGATTTAAGAAAAATCAACCAAGAATTAGGCATCACA
ATTTTAATTAATTTACATTTTGTTGACTTGGCAAAAGAATATGGCACACGCATCATTGGT
TTACGTGATGGTGAAGTTGTCTATGATGGTCCTGCATCTGAAGCAACAGATGACGTATTT
AGTGAAATATATGGACGTACAATTAAAGAAGATGAAAAGCTAGGAGTGAACTAA60
120
180
240
300
360
420
480
540
600
660
720
774
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS00485 [old locus tag: NWMN_0086 ]
- symbol: NWMN_RS00485
- description: phosphonates import ATP-binding protein PhnC
- length: 257
- theoretical pI: 8.43013
- theoretical MW: 28688.8
- GRAVY: -0.225292
⊟Function[edit | edit source]
- reaction: EC 3.6.3.28? ExPASyPhosphonate-transporting ATPase ATP + H2O + phosphonate(Out) = ADP + phosphate + phosphonate(In)
- TIGRFAM: Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 372.3)and 73 moreCellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 175.4)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 174.7)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 162.4)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 153.1)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 151.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 149.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 145.1)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 144.6)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 144.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 144.2)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 141.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 136.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 128.8)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 126.5)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 126.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 120.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 118.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 114.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 113)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 112.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 112.9)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 109.8)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 109.3)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 108.9)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 105.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 105.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 105.1)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 104.9)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 104.9)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 104.4)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 104.1)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 103.4)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 103.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 103.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 101.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 101.2)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 99.3)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 98.2)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.9)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.9)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.9)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 95.6)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 92.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 91.8)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 91.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 86.3)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 83.6)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 82.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 81.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 80.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 79.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 79.8)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 79.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 79.2)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 79.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 73.7)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 73.7)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 68.6)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 68.5)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 66.3)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 64.6)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 62.7)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 60.6)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 55)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 55)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 54.4)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 50.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 41.8)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 38.6)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 35.5)Ti-type conjugative transfer relaxase TraA (TIGR02768; HMM-score: 13.1)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.9)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 12.7)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 115.9)and 18 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 22.9)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 21.3)AAA_22; AAA domain (PF13401; HMM-score: 20.7)AAA_30; AAA domain (PF13604; HMM-score: 18.1)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 17.6)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 17.4)AAA_23; AAA domain (PF13476; HMM-score: 17.1)AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.7)AAA_33; AAA domain (PF13671; HMM-score: 16.7)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 15.6)ABC_ATPase; Predicted ATPase of the ABC class (PF09818; HMM-score: 14.6)AAA_27; AAA domain (PF13514; HMM-score: 14.6)AAA_25; AAA domain (PF13481; HMM-score: 14.3)AAA_18; AAA domain (PF13238; HMM-score: 13.7)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.3)PEP-carboxyk (CL0374) PEPCK_ATP; Phosphoenolpyruvate carboxykinase (PF01293; HMM-score: 11.1)P-loop_NTPase (CL0023) G-alpha; G-protein alpha subunit (PF00503; HMM-score: 11)AAA_15; AAA ATPase domain (PF13175; HMM-score: 10.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004142
- TAT(Tat/SPI): 0.0004
- LIPO(Sec/SPII): 0.000402
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGEIFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLSGRVGYHPTWKMVLGLFPKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDPLTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVFSEIYGRTIKEDEKLGVN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
NWMN_RS11780 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) NWMN_RS00010 DNA polymerase III subunit beta [1] (data from MRSA252) NWMN_RS00100 DNA-binding response regulator [1] (data from MRSA252) NWMN_RS00980 L-lactate dehydrogenase [1] (data from MRSA252) NWMN_RS02010 GTP-binding protein YchF [1] (data from MRSA252) NWMN_RS02915 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_RS02920 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_RS02960 elongation factor G [1] (data from MRSA252) NWMN_RS02965 elongation factor Tu [1] (data from MRSA252) NWMN_RS04215 enolase [1] (data from MRSA252) NWMN_RS04590 NADH dehydrogenase [1] (data from MRSA252) NWMN_RS04935 enoyl-ACP reductase [1] (data from MRSA252) NWMN_RS05380 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) NWMN_RS05385 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) NWMN_RS05390 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) NWMN_RS05395 dihydrolipoyl dehydrogenase [1] (data from MRSA252) NWMN_RS06210 cell division protein FtsZ [1] (data from MRSA252) NWMN_RS06490 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_RS06575 30S ribosomal protein S2 [1] (data from MRSA252) NWMN_RS07455 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) NWMN_RS07460 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) NWMN_RS07605 serine/threonine dehydratase [1] (data from MRSA252) NWMN_RS08350 molecular chaperone DnaK [1] (data from MRSA252) NWMN_RS08685 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_RS08865 aldehyde dehydrogenase [1] (data from MRSA252) NWMN_RS08905 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) NWMN_RS08930 pyruvate kinase [1] (data from MRSA252) NWMN_RS08995 universal stress protein UspA [1] (data from MRSA252) NWMN_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) NWMN_RS10560 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [1] (data from MRSA252) NWMN_RS11705 aldehyde dehydrogenase family protein [1] (data from MRSA252) NWMN_RS11715 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) NWMN_RS12305 30S ribosomal protein S13 [1] (data from MRSA252) NWMN_RS12330 50S ribosomal protein L15 [1] (data from MRSA252) NWMN_RS12340 30S ribosomal protein S5 [1] (data from MRSA252) NWMN_RS12350 50S ribosomal protein L6 [1] (data from MRSA252) NWMN_RS12365 50S ribosomal protein L5 [1] (data from MRSA252) NWMN_RS12395 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_RS12400 50S ribosomal protein L22 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)