From AureoWiki
Revision as of 15:12, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2380 [new locus tag: NWMN_RS13710 ]
  • symbol: NWMN_2380
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2615846..2616133
  • length: 288
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID: 5331462 NCBI
  • RefSeq: YP_001333414 NCBI

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    GTGGGACTTGATTTTAGTGGTTTACCAGATTTAGCAGTATTGGAACAAATGAAGGAAAAA
    GAACAGATTAGTGAGGTTATTGCGCCTGAACATGTTCGTATGCATCATGATCATCAAAAT
    AAGCTGAAAAGTGATGAGAAAATATTACTTGACCAAATGGTAAGTCATTTCAAAAAATTT
    GAAGATGATTTTAAAAATGCGGCACAAGGGGCTTGGGTGAAAAATGCCACAGACGAATTA
    AAAGATATTAGTAATGATTTAGAAAAAATTCAAGATATTAAAGTATAA
    60
    120
    180
    240
    288

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2380 [new locus tag: NWMN_RS13710 ]
  • symbol: NWMN_2380
  • description: hypothetical protein
  • length: 95
  • theoretical pI: 4.93252
  • theoretical MW: 10971.4
  • GRAVY: -0.697895

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    YycI_YycH (CL0285) YycH; YycH protein (PF07435; HMM-score: 15.2)
    no clan defined Nuc_rec_co-act; Nuclear receptor coactivator (PF08815; HMM-score: 14.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002111
    • TAT(Tat/SPI): 0.000151
    • LIPO(Sec/SPII): 0.000276
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 151222592 NCBI
  • UniProt: A0A0H3KAG3 UniProt
  • protein Genbank : _
  • RefSeq: YP_001333414 NCBI

Protein sequence[edit | edit source]

  • MGLDFSGLPDLAVLEQMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKKFEDDFKNAAQGAWVKNATDELKDISNDLEKIQDIKV

Peptides[edit | edit source]

  • experimentally validated:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]