Jump to navigation
Jump to search
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene GI</aureodatabase> | *<aureodatabase>gene GI</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene RefSeq</aureodatabase> | ||
*<aureodatabase>gene BioCyc</aureodatabase> | |||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 78: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 97: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 106: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 107: | Line 114: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 124: | Line 134: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 130: | Line 140: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 137: | Line 146: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 143: | Line 152: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 21:47, 10 March 2016
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2347 [new locus tag: NWMN_RS13520 ]
- pan locus tag?: SAUPAN006000000
- symbol: opuCA
- pan gene symbol?: opuCA
- synonym:
- product: glycine betaine/L-proline transport ATP-binding subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2347 [new locus tag: NWMN_RS13520 ]
- symbol: opuCA
- product: glycine betaine/L-proline transport ATP-binding subunit
- replicon: chromosome
- strand: -
- coordinates: 2580838..2582064
- length: 1227
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332228 NCBI
- RefSeq: YP_001333381 NCBI
- BioCyc:
- MicrobesOnline: 3707949 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201ATGTTAAGTATTAAGCATTTAACGAAAATTTATTCTGGTAATAAAAAGGCAGTAGATGAC
ATCTCTTTAGATATTCAATCTGGGGAATTTATCGCATTTATTGGAACCAGTGGAAGTGGC
AAAACGACTGCTTTAAGAATGATAAACCGTATGATTGAAGCGACAGAAGGACAAATTGAA
ATTGATGGTAAAGATGTTCGGAGTATGAATCCTGTCGAATTGCGTAGAAATATTGGCTAT
GTTATTCAACAAATTGGCTTAATGCCTCATATGACGATTAAAGAGAATATTGTGTTGGTA
CCCAAATTGTTGAAATGGACTAAAGAGGAAAAGGATAAACGTGCAAAGGAATTAATTAAA
CTTGTGGATTTACCGGAGTCATTTTTAGAGCGTTATCCAGCAGAACTATCAGGTGGGCAA
CAACAACGTATCGGTGTTGTAAGAGCACTTGCGGCCGAACAAGATATTATTTTAATGGAT
GAACCTTTTGGTGCATTGGATCCTATTACGAGAGATACGTTACAAGATTTAGTTAAAACG
TTACAACGAAAATTAGGCAAGACGTTTATCTTTGTAACACATGATATGGATGAAGCGATT
AAATTAGCAGACAAAATTTGTATTATGTCAGAAGGTAAGGTGGTGCAATTTGATACGCCA
GACAATATTTTAAGACATCCCGCAAATGATTTTGTACGTGATTTTATAGGACAAAATAGA
CTGATTCAAGACCGTCCCAATGACAAGACTGTAGAAGGTGTAATGATTAAACCAATCACG
ATACAAGCAGAAGCAACACTGAATGACGCCGTTCATATTATGAGACAAAAACGTGTTGAT
ACTATTTTTGTAGTAGATAGTAATAACCATTTACTAGGTTTCTTAGACATTGAAGATATA
AATCAGGGTATACGTGGACACAAAAGTTTACGAGACACCATGCAACAACATATTTATACC
GTTCAAATTGATTCTAAATTACAAGATTCTGTACGTACGATTTTAAAAAGAAACGTTAGG
AATGTACCTGTCGTAGATGATCAACAGCGTTTAGTAGGACTGATTACGCGTGCCAATGTT
GTTGATATTGTATATGACACGATTTGGGGCGATAGTGAGGATACAGTGCAAACAGAACAT
GTGGGGGAAGACACTGCGTCCTCAAAAGTGCATGAGCAACACACTACTAATGTCAAAGTA
CGTGACATAGGAGATGATAAATCATGA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1227
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2347 [new locus tag: NWMN_RS13520 ]
- symbol: OpuCA
- description: glycine betaine/L-proline transport ATP-binding subunit
- length: 408
- theoretical pI: 6.15286
- theoretical MW: 46173.6
- GRAVY: -0.347549
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 457.3)and 77 moreTransport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 246.6)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 244.9)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 232)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 224.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 202)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 192)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 190.5)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 177.3)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 175.7)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 170.5)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 166)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 159.2)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 155.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 155.2)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 154.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 153.2)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 153.2)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 152)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 148.7)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 147.8)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 147.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 147.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 146.5)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 146.5)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 146)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 144.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 139.5)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 136.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 135.7)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 133.5)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 131.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 126.3)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 126.1)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 123.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 122.9)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 122.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 121)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 121)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 119.2)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 114.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 114)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 114)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 112.7)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 108.5)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 108.5)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 108.5)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 108.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 106.1)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 106.1)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 105.4)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 102.2)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 99.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 99.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 97)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 95.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 94)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 91.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.6)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 84.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 80.9)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 76.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 62.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 61.7)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 58.5)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 58.5)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 54.6)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 47.4)Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis inosine-5'-monophosphate dehydrogenase (TIGR01302; EC 1.1.1.205; HMM-score: 45.4)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 41.6)Energy metabolism Sugars sugar isomerase, KpsF/GutQ family (TIGR00393; HMM-score: 36.7)Transport and binding proteins Cations and iron carrying compounds magnesium transporter (TIGR00400; HMM-score: 35.5)Unknown function General IMP dehydrogenase family protein (TIGR01303; HMM-score: 25.5)Amino acid biosynthesis Serine family cystathionine beta-synthase (TIGR01137; EC 4.2.1.22; HMM-score: 24.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 20.3)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 13.4)Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 115.5)and 14 moreno clan defined CBS; CBS domain (PF00571; HMM-score: 61.5)P-loop_NTPase (CL0023) AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 27.3)AAA_15; AAA ATPase domain (PF13175; HMM-score: 21.7)Zeta_toxin; Zeta toxin (PF06414; HMM-score: 19.3)AAA_16; AAA ATPase domain (PF13191; HMM-score: 18.5)NTPase_1; NTPase (PF03266; HMM-score: 17.9)AAA_22; AAA domain (PF13401; HMM-score: 17.5)AAA_30; AAA domain (PF13604; HMM-score: 17.2)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 16.8)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 15.4)AAA_18; AAA domain (PF13238; HMM-score: 15)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 14.8)AAA_28; AAA domain (PF13521; HMM-score: 14.4)SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004967
- TAT(Tat/SPI): 0.000629
- LIPO(Sec/SPII): 0.000633
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLSIKHLTKIYSGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQIEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKELIKLVDLPESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQNRLIQDRPNDKTVEGVMIKPITIQAEATLNDAVHIMRQKRVDTIFVVDSNNHLLGFLDIEDINQGIRGHKSLRDTMQQHIYTVQIDSKLQDSVRTILKRNVRNVPVVDDQQRLVGLITRANVVDIVYDTIWGDSEDTVQTEHVGEDTASSKVHEQHTTNVKVRDIGDDKS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: opuCD < opuCC < opuCB < opuCA
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.