NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2143 [new locus tag: NWMN_RS12380 ]
- pan locus tag?: SAUPAN005693000
- symbol: rpsQ
- pan gene symbol?: rpsQ
- synonym:
- product: 30S ribosomal protein S17
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2143 [new locus tag: NWMN_RS12380 ]
- symbol: rpsQ
- product: 30S ribosomal protein S17
- replicon: chromosome
- strand: -
- coordinates: 2370751..2371014
- length: 264
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332377 NCBI
- RefSeq: YP_001333177 NCBI
- BioCyc:
- MicrobesOnline: 3707745 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGAGCGAAAGAAACGATCGTAAAGTTTATGTAGGTAAAGTTGTTTCAGACAAAATGGAC
AAGACTATTACAGTACTTGTTGAAACTTACAAAACACACAAATTATACGGTAAACGAGTA
AAATACTCTAAAAAATACAAAACTCATGATGAAAACAATTCAGCTAAATTAGGAGACATT
GTTAAAATTCAAGAAACTCGTCCTTTATCAGCAACAAAACGTTTTCGTTTAGTAGAGATT
GTTGAAGAGTCAGTAATTATTTAA60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2143 [new locus tag: NWMN_RS12380 ]
- symbol: RpsQ
- description: 30S ribosomal protein S17
- length: 87
- theoretical pI: 10.362
- theoretical MW: 10174.8
- GRAVY: -0.696552
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS17 (TIGR03635; HMM-score: 115.3)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS17 (TIGR03630; HMM-score: 40.3)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: OB (CL0021) Ribosomal_S17; Ribosomal protein S17 (PF00366; HMM-score: 108.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007954
- TAT(Tat/SPI): 0.000534
- LIPO(Sec/SPII): 0.001166
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSERNDRKVYVGKVVSDKMDKTITVLVETYKTHKLYGKRVKYSKKYKTHDENNSAKLGDIVKIQETRPLSATKRFRLVEIVEESVII
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
NWMN_0961 (pdhC) branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) NWMN_0962 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) NWMN_0959 (phdA) pyruvate dehydrogenase E1 component, alpha subunit [1] (data from MRSA252) NWMN_0960 (phdB) pyruvate dehydrogenase E1 component, beta subunit [1] (data from MRSA252) NWMN_0500 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_0510 (tufA) elongation factor Tu [1] (data from MRSA252) NWMN_0641 hypothetical protein [1] (data from MRSA252) NWMN_1638 glutamyl-aminopeptidase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)