NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2112 [new locus tag: NWMN_RS12225 ]
- pan locus tag?: SAUPAN005631000
- symbol: NWMN_2112
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2112 [new locus tag: NWMN_RS12225 ]
- symbol: NWMN_2112
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2350913..2351095
- length: 183
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331734 NCBI
- RefSeq: YP_001333146 NCBI
- BioCyc:
- MicrobesOnline: 3707714 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGAAAGATTCTATATTTTGGAAGAAAGCTTTTATTCCTGTTTATTTTATTGTTGCGATG
CTGGTGTTTCTACTTTTTAGGTTTTATATTAAAACAGATAACTTTTCTATATATTTAATG
AGTATCTTCTTAATTTGTTTAGGAACTGCTTCTATCATTTATAACTATAAAACCAATCGA
TAA60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2112 [new locus tag: NWMN_RS12225 ]
- symbol: NWMN_2112
- description: hypothetical protein
- length: 60
- theoretical pI: 10.0374
- theoretical MW: 7233.75
- GRAVY: 0.853333
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for NCTC8325
- PFAM: no clan defined CLLAC; CLLAC-motif containing domain (PF15675; HMM-score: 12.6)Smim3; Small integral membrane protein 3 (PF17307; HMM-score: 12.4)DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 11.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004019
- TAT(Tat/SPI): 0.00019
- LIPO(Sec/SPII): 0.010505
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKDSIFWKKAFIPVYFIVAMLVFLLFRFYIKTDNFSIYLMSIFLICLGTASIIYNYKTNR
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.